StarFunc result for job id Q9NYI0

User Input

>input (1048 residues)
MEGRSAAAETFVWVNNASAHSQSVAKAKYEFLFGRSEGKAPDTSDHGGSTLLPPNVTNEF
PEYGTMEEGGEGLRASLEFDGEALPCHPQEQQGVQPLTGCHSGLDSVTEGPKDVREAPSQ
SHLKEQSLQPIDSLISALKATEARIISGTLQATKVLDQDAVSSFSVQQVEKELDTASRKT
QRVNKTLPAGQKNLPEIPLSAEVTTEESFYLSIQKDLTALLTGDTQAEISQIMNNGRKGA
VCVQEPSCPLASLGSSAVTCHSAGSVGFLKEQRSALGREHPGGCDRSSSMGRPGRVKHVE
FQGVEILWTGGDKRETQHPIDFETSLQRTASPDSKESSKVPRHLISSAGLCNSSSLTENV
WDESWKAPSERPGTSSGTFSPVRLDESGEDEVFLQENKQHLEKTPKPERDRERISEQEEH
VKGEDEDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTP
MIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGYSSGVTNGLNDASDSIYTKGTPEI
AFWGSNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKR
SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFS
NRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHVNIGKKMTCQEFIANLQGVNEGVDFS
KDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPH
DPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEE
DLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVF
SAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVK
AKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTS
PITAKVKRNVSERKDHRPETPSIKQKVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2PFD7	0.510	0.515	0.000	1037	0.808	0.817	Q2PFD7.pdb.gz	PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Psd3 PE=1 SV=2
2	AFDB:Q8NDX1	0.350	0.348	1.623E-47	1056	0.317	0.314	Q8NDX1.pdb.gz	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
3	PDB:6bbpA	0.149	0.295	4.838E-18	520	0.079	0.160	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
4	PDB:6u3eA	0.147	0.373	5.230E-17	397	0.081	0.214	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
5	AFDB:P91620	0.152	0.083	3.914E-9	2061	0.153	0.078	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
6	AFDB:P91621	0.152	0.082	1.055E-8	2072	0.154	0.078	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
7	AFDB:Q6DFV3	0.100	0.055	5.461E-6	1944	0.147	0.079	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
8	AFDB:Q54YZ6	0.082	0.072	1.796E-5	1218	0.102	0.088	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
9	AFDB:Q54DW4	0.085	0.068	1.242E-4	1350	0.135	0.105	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
10	AFDB:Q6ZNL6	0.106	0.081	3.350E-4	1462	0.138	0.099	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
11	PDB:7rx9A	0.079	0.179	3.421E-4	432	0.043	0.104	7rx9A.pdb.gz
12	AFDB:P34288	0.094	0.063	4.981E-4	1605	0.122	0.080	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
13	PDB:3ljuX	0.083	0.220	1.515E-3	373	0.014	0.040	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:4mt6A	0.086	0.211	2.613E-3	389	0.037	0.100	4mt6A.pdb.gz
15	AFDB:F4IZM8	0.089	0.073	6.566E-3	1347	0.113	0.088	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
16	PDB:4uudC	0.080	0.592	1.101E-2	113	0.024	0.221	4uudC.pdb.gz
17	PDB:4mk0A	0.081	0.132	1.216E-2	631	0.011	0.019	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:3pvuA	0.077	0.129	3.998E-2	609	0.012	0.021	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:4gouA	0.083	0.155	4.639E-2	507	0.029	0.059	4gouA.pdb.gz
20	PDB:2qkmG	0.070	0.431	5.945E-2	127	0.013	0.110	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IAG2	0.0	629	837	0.318	0.398	A0A0R4IAG2_DANRE PH and SEC7 domain-containing protein 2 isoform X2 OS=Danio rerio OX=7955 GN=psd2 PE=4 SV=1
2	A5PKW4	0.0	600	1024	0.279	0.285	PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PSD PE=1 SV=2
3	Q2PFD7	0.0	1691	1037	0.808	0.817	PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Psd3 PE=1 SV=2
4	Q5DTT2	0.0	592	1024	0.271	0.277	PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Psd PE=1 SV=2
5	Q6P1I6	0.0	631	770	0.323	0.440	PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Psd2 PE=1 SV=1
6	Q9ESQ7	0.0	588	649	0.270	0.436	PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Psd PE=1 SV=1
7	Q8NDX1	5.22e-147	468	1056	0.230	0.228	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
8	E1JIT7	3.68e-126	422	1601	0.202	0.132	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
9	G5EET6	2.88e-75	267	818	0.158	0.203	EFA6_CAEEL Exchange factor for Arf-6 OS=Caenorhabditis elegans OX=6239 GN=efa-6 PE=1 SV=1
10	O43739	1.58e-26	115	400	0.056	0.147	CYH3_HUMAN Cytohesin-3 OS=Homo sapiens OX=9606 GN=CYTH3 PE=1 SV=2
11	P97694	2.06e-26	115	398	0.095	0.251	CYH1_RAT Cytohesin-1 OS=Rattus norvegicus OX=10116 GN=Cyth1 PE=1 SV=1
12	Q9QX11	2.06e-26	115	398	0.095	0.251	CYH1_MOUSE Cytohesin-1 OS=Mus musculus OX=10090 GN=Cyth1 PE=1 SV=2
13	O08967	1.59e-25	112	399	0.054	0.143	CYH3_MOUSE Cytohesin-3 OS=Mus musculus OX=10090 GN=Cyth3 PE=1 SV=1
14	Q15438	2.29e-25	112	398	0.092	0.241	CYH1_HUMAN Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 SV=1
15	Q2KI41	5.43e-25	111	410	0.088	0.224	CYH2_BOVIN Cytohesin-2 OS=Bos taurus OX=9913 GN=CYTH2 PE=2 SV=1
16	Q6PC26	1.13e-24	110	399	0.054	0.143	Q6PC26_DANRE Cytohesin-1 OS=Danio rerio OX=7955 GN=zgc:73134 PE=2 SV=1
17	P63034	1.47e-24	109	400	0.089	0.233	CYH2_MOUSE Cytohesin-2 OS=Mus musculus OX=10090 GN=Cyth2 PE=1 SV=3
18	P63035	1.47e-24	109	400	0.089	0.233	CYH2_RAT Cytohesin-2 OS=Rattus norvegicus OX=10116 GN=Cyth2 PE=1 SV=1
19	Q6PW01	2.27e-24	108	398	0.053	0.141	Q6PW01_DANRE Cytohesin 1-like protein OS=Danio rerio OX=7955 GN=cyth1 PE=2 SV=1
20	Q99418	4.62e-24	108	400	0.088	0.230	CYH2_HUMAN Cytohesin-2 OS=Homo sapiens OX=9606 GN=CYTH2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.6e-11	56.0	PH domain
2	PF15413 PH_11	2.8e+02	13.4	Pleckstrin homology domain
3	PF15410 PH_9	4.1e-37	138.5	Pleckstrin homology domain
4	PF01369 Sec7	1.3e-38	144.0	Sec7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298316	0.743	ADP-ribosylation factor 6
2	9606.ENSP00000368402	0.699	BTB/POZ domain-containing protein KCTD4
3	9606.ENSP00000430985	0.672	Ankyrin repeat domain-containing protein 6
4	9606.ENSP00000346378	0.649	Amyloid-beta A4 precursor protein-binding family B member 3
5	9606.ENSP00000295777	0.638	Neuroserpin
6	9606.ENSP00000361663	0.595	Interleukin 1 receptor accessory protein like 2
7	9606.ENSP00000334840	0.565	Proline-rich nuclear receptor coactivator 2
8	9606.ENSP00000219689	0.532	Ubiquitin carboxyl-terminal hydrolase 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	0.999	guanyl-nucleotide exchange factor activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.933	response to stimulus
GO:0051716	0.877	cellular response to stimulus
GO:0023052	0.752	signaling
GO:0007154	0.752	cell communication
GO:0007165	0.744	signal transduction
GO:0007264	0.643	small GTPase mediated signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0120025	0.978	plasma membrane bounded cell projection
GO:0031252	0.974	cell leading edge
GO:0031256	0.940	leading edge membrane
GO:0032587	0.926	ruffle membrane
GO:0005737	0.823	cytoplasm
GO:0043231	0.812	intracellular membrane-bounded organelle
GO:0043228	0.365	non-membrane-bounded organelle
GO:0043232	0.361	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]