StarFunc result for job id Q9NYJ8

User Input

>input (693 residues)
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U303	0.374	0.374	5.278E-89	693	0.939	0.939	Q5U303.pdb.gz	TAB2_RAT TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Tab2 PE=2 SV=2
2	AFDB:Q5RFW2	0.216	0.211	2.296E-49	711	0.579	0.564	Q5RFW2.pdb.gz	TAB2_DANRE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Danio rerio OX=7955 GN=tab2 PE=1 SV=1
3	AFDB:Q8N5C8	0.115	0.113	9.060E-26	712	0.398	0.388	Q8N5C8.pdb.gz	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
4	AFDB:Q96PV0	0.120	0.071	5.859E-4	1343	0.144	0.074	Q96PV0.pdb.gz	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
5	AFDB:Q9W3D1	0.129	0.083	9.718E-4	1183	0.121	0.071	Q9W3D1.pdb.gz	Q9W3D1_DROME Chromatin assembly factor 1, p180 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-180 PE=1 SV=1
6	AFDB:P53352	0.132	0.109	7.836E-3	877	0.146	0.115	P53352.pdb.gz	INCE_CHICK Inner centromere protein OS=Gallus gallus OX=9031 GN=INCENP PE=1 SV=1
7	AFDB:F4INW9	0.128	0.118	2.156E-2	760	0.126	0.114	F4INW9.pdb.gz	MYOB4_ARATH Probable myosin-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=MYOB4 PE=3 SV=1
8	AFDB:E7F1U4	0.101	0.055	3.151E-2	1507	0.152	0.070	E7F1U4.pdb.gz	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
9	AFDB:P25653	0.052	0.028	1.532E-1	1609	0.139	0.060	P25653.pdb.gz	FIG2_YEAST Factor-induced gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG2 PE=1 SV=2
10	AFDB:F4I1G1	0.074	0.063	1.852E-1	831	0.179	0.149	F4I1G1.pdb.gz	F4I1G1_ARATH RNA polymerase II degradation factor-like protein (DUF1296) OS=Arabidopsis thaliana OX=3702 GN=At1g29350 PE=1 SV=1
11	PDB:3ljuX	0.037	0.065	1.280	373	0.007	0.013	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	PDB:4uhvB	0.038	0.040	2.567	645	0.029	0.031	4uhvB.pdb.gz
13	PDB:3ms6A	0.035	0.206	2.914	91	0.004	0.033	3ms6A.pdb.gz
14	PDB:6nzdF	0.026	0.057	2.914	227	0.007	0.022	6nzdF.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
15	PDB:2hi3A	0.050	0.293	3.104	73	0.012	0.110	2hi3A.pdb.gz
16	PDB:1okgA	0.030	0.055	4.536	362	0.007	0.014	1okgA.pdb.gz	The Crystal Structure of Leishmania Major 3-Mercaptopyruvate Sulfurtransferase: A Three-Domain Architecture with a Serine Protease-Like Triad at the Active Site
17	PDB:4i82A	0.027	0.098	4.832	121	0.009	0.050	4i82A.pdb.gz
18	PDB:6c95D	0.057	0.389	4.832	95	0.009	0.063	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
19	PDB:4cizA	0.062	0.134	5.148	284	0.013	0.032	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
20	PDB:7q3dC	0.039	0.058	5.148	393	0.009	0.015	7q3dC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5RFW2	0.0	649	711	0.584	0.570	TAB2_DANRE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Danio rerio OX=7955 GN=tab2 PE=1 SV=1
2	Q5U303	0.0	1334	693	0.939	0.939	TAB2_RAT TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Tab2 PE=2 SV=2
3	Q99K90	0.0	1336	693	0.947	0.947	TAB2_MOUSE TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Mus musculus OX=10090 GN=Tab2 PE=1 SV=1
4	Q9NYJ8	0.0	1430	693	1.000	1.000	TAB2_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Homo sapiens OX=9606 GN=TAB2 PE=1 SV=1
5	Q8N5C8	8.12e-108	345	712	0.426	0.414	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
6	Q4TZQ4	0.037	39.7	831	0.022	0.018	Q4TZQ4_DROME TAK1-binding protein OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
7	Q6NQZ7	0.037	39.7	831	0.022	0.018	Q6NQZ7_DROME LD40663p OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
8	Q9NFL3	0.037	39.7	831	0.022	0.018	Q9NFL3_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
9	A0A0B4KG87	0.041	39.7	820	0.022	0.018	A0A0B4KG87_DROME TAK1-associated binding protein 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=4 SV=1
10	Q8TAT6	0.066	38.9	608	0.019	0.021	NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3
11	Q9ES54	0.071	38.9	608	0.019	0.021	NPL4_RAT Nuclear protein localization protein 4 homolog OS=Rattus norvegicus OX=10116 GN=Nploc4 PE=1 SV=3
12	B2RXY9	0.072	38.9	607	0.088	0.100	B2RXY9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
13	P60670	0.072	38.9	608	0.019	0.021	NPL4_MOUSE Nuclear protein localization protein 4 homolog OS=Mus musculus OX=10090 GN=Nploc4 PE=1 SV=3
14	A0JMQ9	0.13	38.1	716	0.019	0.018	ZRN1B_DANRE Ubiquitin thioesterase zranb1-B OS=Danio rerio OX=7955 GN=zranb1b PE=2 SV=1
15	A2A5N3	0.24	37.0	607	0.087	0.099	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
16	Q9VBP9	0.32	36.6	652	0.019	0.020	NPL4_DROME Nuclear protein localization protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Npl4 PE=1 SV=3
17	Q5SP48	0.39	35.4	184	0.017	0.065	Q5SP48_DANRE YY1-associated factor 2 OS=Danio rerio OX=7955 GN=si:ch211-155a11.5 PE=4 SV=1
18	Q9UGI0	0.48	36.2	708	0.022	0.021	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
19	Q24498	0.57	36.2	5127	0.038	0.005	RYR_DROME Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3
20	Q9I7U4	0.60	36.2	18141	0.039	0.001	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02845 CUE	8.5e-06	36.7	CUE domain
2	PF16515 HIP1_clath_bdg	19	17.0	Clathrin-binding domain of Huntingtin-interacting protein 1
3	PF00641 zf-RanBP	0.058	24.0	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356426

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216160	0.999	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
2	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
4	9606.ENSP00000358335	0.999	Mitogen-activated protein kinase kinase kinase 7
5	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
6	9606.ENSP00000483825	0.998	NF-kappa-B essential modulator
7	9606.ENSP00000358997	0.997	Interleukin-1 receptor-associated kinase 1
8	9606.ENSP00000247668	0.996	TNF receptor-associated factor 2
9	9606.ENSP00000342235	0.996	Receptor tyrosine-protein kinase erbB-4
10	9606.ENSP00000441543	0.995	Polyubiquitin-C
11	9606.ENSP00000162749	0.988	Tumor necrosis factor receptor superfamily member 1A
12	9606.ENSP00000359424	0.988	Inhibitor of nuclear factor kappa-B kinase subunit alpha
13	9606.ENSP00000262158	0.986	Mothers against decapentaplegic homolog 7
14	9606.ENSP00000430684	0.986	Inhibitor of nuclear factor kappa-B kinase subunit beta
15	9606.ENSP00000398698	0.984	Tumor necrosis factor
16	9606.ENSP00000316176	0.981	Ubiquitin-conjugating enzyme E2 N
17	9606.ENSP00000272317	0.978	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000340305	0.975	Ubiquitin-conjugating enzyme E2 variant 1
19	9606.ENSP00000341268	0.966	Tumor necrosis factor receptor type 1-associated DEATH domain protein
20	9606.ENSP00000392025	0.966	Ubiquitin carboxyl-terminal hydrolase CYLD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0070530	0.307	K63-linked polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0010604	0.995	positive regulation of macromolecule metabolic process
GO:0042325	0.991	regulation of phosphorylation
GO:0044093	0.989	positive regulation of molecular function
GO:0048522	0.988	positive regulation of cellular process
GO:0031401	0.988	positive regulation of protein modification process
GO:0050790	0.986	regulation of catalytic activity
GO:0010033	0.986	response to organic substance
GO:0051707	0.986	response to other organism
GO:0009892	0.984	negative regulation of metabolic process
GO:0001932	0.973	regulation of protein phosphorylation
GO:0051347	0.971	positive regulation of transferase activity
GO:0031324	0.970	negative regulation of cellular metabolic process
GO:0042327	0.965	positive regulation of phosphorylation
GO:0001934	0.964	positive regulation of protein phosphorylation
GO:0045859	0.955	regulation of protein kinase activity
GO:0009967	0.954	positive regulation of signal transduction
GO:0043122	0.946	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.944	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032501	0.941	multicellular organismal process
GO:0009894	0.928	regulation of catabolic process
GO:0045860	0.921	positive regulation of protein kinase activity
GO:0032502	0.919	developmental process
GO:1901700	0.918	response to oxygen-containing compound
GO:0007507	0.905	heart development
GO:0009895	0.900	negative regulation of catabolic process
GO:0009617	0.897	response to bacterium
GO:0033993	0.887	response to lipid
GO:0010506	0.887	regulation of autophagy
GO:0031330	0.825	negative regulation of cellular catabolic process
GO:0009987	0.747	cellular process
GO:0051716	0.622	cellular response to stimulus
GO:0010468	0.572	regulation of gene expression
GO:0002237	0.572	response to molecule of bacterial origin
GO:0010507	0.557	negative regulation of autophagy
GO:0032496	0.449	response to lipopolysaccharide
GO:0008152	0.353	metabolic process
GO:0009889	0.342	regulation of biosynthetic process
GO:0071704	0.326	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0012505	0.993	endomembrane system
GO:0005886	0.980	plasma membrane
GO:0031982	0.804	vesicle
GO:0031090	0.780	organelle membrane
GO:0031410	0.649	cytoplasmic vesicle
GO:0030659	0.634	cytoplasmic vesicle membrane
GO:0005768	0.620	endosome
GO:0010008	0.559	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]