StarFunc result for job id Q9NYK1

User Input

>input (1049 residues)
MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58681	0.805	0.804	0.000	1050	0.807	0.807	P58681.pdb.gz	TLR7_MOUSE Toll-like receptor 7 OS=Mus musculus OX=10090 GN=Tlr7 PE=1 SV=1
2	AFDB:Q5ZJD0	0.797	0.790	0.000	1059	0.638	0.632	Q5ZJD0.pdb.gz	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
3	AFDB:Q9NYK1	1.000	1.000	0.000	1049	1.000	1.000	Q9NYK1.pdb.gz	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
4	AFDB:Q9NR97	0.792	0.797	4.848E-89	1041	0.425	0.428	Q9NR97.pdb.gz	TLR8_HUMAN Toll-like receptor 8 OS=Homo sapiens OX=9606 GN=TLR8 PE=1 SV=1
5	AFDB:P58682	0.728	0.740	1.351E-87	1032	0.434	0.441	P58682.pdb.gz	TLR8_MOUSE Toll-like receptor 8 OS=Mus musculus OX=10090 GN=Tlr8 PE=1 SV=2
6	AFDB:A0A2R8QA47	0.737	0.724	2.736E-76	1069	0.352	0.345	A0A2R8QA47.pdb.gz
7	AFDB:Q9NR96	0.712	0.724	3.362E-74	1032	0.350	0.356	Q9NR96.pdb.gz	TLR9_HUMAN Toll-like receptor 9 OS=Homo sapiens OX=9606 GN=TLR9 PE=1 SV=2
8	AFDB:Q5I2M5	0.729	0.743	7.221E-74	1029	0.353	0.360	Q5I2M5.pdb.gz	TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus OX=9913 GN=TLR9 PE=1 SV=1
9	AFDB:Q9EQU3	0.769	0.781	1.856E-73	1032	0.354	0.359	Q9EQU3.pdb.gz	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
10	AFDB:Q2EEY0	0.710	0.722	7.827E-73	1031	0.358	0.365	Q2EEY0.pdb.gz	TLR9_HORSE Toll-like receptor 9 OS=Equus caballus OX=9796 GN=TLR9 PE=1 SV=1
11	PDB:3j0aA	0.252	0.301	8.280E-22	797	0.176	0.232	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.404	0.579	1.064E-19	668	0.162	0.254	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3t6qA	0.393	0.612	8.340E-18	601	0.144	0.251	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:3b2dA	0.314	0.461	1.565E-17	601	0.146	0.255	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:7tvfD	0.202	0.366	1.455E-14	515	0.124	0.252	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
16	PDB:6gffI	0.208	0.350	3.418E-14	551	0.134	0.256	6gffI.pdb.gz
17	PDB:7wrqA	0.217	0.355	6.019E-12	566	0.140	0.260	7wrqA.pdb.gz
18	PDB:1xcdA	0.206	0.636	1.060E-9	305	0.078	0.269	1xcdA.pdb.gz
19	PDB:5yq5B	0.212	0.631	7.592E-8	306	0.068	0.232	5yq5B.pdb.gz
20	PDB:2ft3F	0.195	0.604	9.087E-8	305	0.073	0.252	2ft3F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8SZH4	0.0	574	1074	0.369	0.360	A8SZH4_SALSA Toll-like receptor 9 OS=Salmo salar OX=8030 GN=TLR9 PE=2 SV=1
2	M0RAA8	0.0	561	1032	0.351	0.357	M0RAA8_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=3 SV=1
3	P58681	0.0	1711	1050	0.808	0.808	TLR7_MOUSE Toll-like receptor 7 OS=Mus musculus OX=10090 GN=Tlr7 PE=1 SV=1
4	P58682	0.0	797	1032	0.430	0.437	TLR8_MOUSE Toll-like receptor 8 OS=Mus musculus OX=10090 GN=Tlr8 PE=1 SV=2
5	Q2EEY0	0.0	575	1031	0.357	0.364	TLR9_HORSE Toll-like receptor 9 OS=Equus caballus OX=9796 GN=TLR9 PE=1 SV=1
6	Q5GQ97	0.0	1375	1046	0.637	0.639	Q5GQ97_CHICK Toll-like receptor 7 (Fragment) OS=Gallus gallus OX=9031 GN=TLR7 PE=3 SV=1
7	Q5ZJD0	0.0	1371	1059	0.635	0.629	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
8	Q6Y1S0	0.0	560	1032	0.350	0.356	Q6Y1S0_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
9	Q9EQU3	0.0	557	1032	0.360	0.366	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
10	Q9NR96	0.0	575	1032	0.357	0.362	TLR9_HUMAN Toll-like receptor 9 OS=Homo sapiens OX=9606 GN=TLR9 PE=1 SV=2
11	Q9NR97	0.0	780	1041	0.421	0.425	TLR8_HUMAN Toll-like receptor 8 OS=Homo sapiens OX=9606 GN=TLR8 PE=1 SV=1
12	Q9NYK1	0.0	2147	1049	1.000	1.000	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
13	Q5I2M5	3.30e-179	552	1029	0.358	0.365	TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus OX=9913 GN=TLR9 PE=1 SV=1
14	B3DJW3	9.67e-179	551	1057	0.360	0.358	B3DJW3_DANRE Toll-like receptor 9 OS=Danio rerio OX=7955 GN=sb:eu392 PE=2 SV=1
15	Q80XA5	1.06e-62	220	388	0.130	0.351	Q80XA5_RAT Toll-like receptor 9 (Fragment) OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
16	A0A2R8RTN4	4.75e-55	210	955	0.252	0.276	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
17	Q5ZJ34	3.40e-53	204	972	0.252	0.272	Q5ZJ34_CHICK TIR domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_21a21 PE=2 SV=1
18	Q6R5N8	8.55e-53	203	991	0.267	0.283	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
19	Q0PQ88	4.78e-48	187	896	0.240	0.281	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2
20	F8W4F1	1.08e-43	174	881	0.213	0.253	F8W4F1_DANRE Toll-like receptor 5 OS=Danio rerio OX=7955 GN=tlr5a PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	5.1e-08	43.1	Leucine Rich Repeat
2	PF18837 LRR_12	9.9e-05	33.2	Leucine-rich repeat
3	PF12799 LRR_4	1.8e-31	118.8	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	1.9e-10	52.2	BspA type Leucine rich repeat region (6 copies)
5	PF13516 LRR_6	1.9	19.8	Leucine Rich repeat
6	PF13855 LRR_8	1.4e-68	237.9	Leucine rich repeat
7	PF14580 LRR_9	9.2e-06	36.8	Leucine-rich repeat
8	PF01582 TIR	1.5e-09	49.4	TIR domain
9	PF13676 TIR_2	0.00045	32.2	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370034

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.999	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000227471	0.995	Protein unc-93 homolog B1
3	9606.ENSP00000358997	0.977	Interleukin-1 receptor-associated kinase 1
4	9606.ENSP00000433623	0.970	TNF receptor-associated factor 6
5	9606.ENSP00000357981	0.961	Cathepsin S
6	9606.ENSP00000380697	0.944	Interferon regulatory factor 7
7	9606.ENSP00000316176	0.926	Ubiquitin-conjugating enzyme E2 N
8	9606.ENSP00000345672	0.926	Cathepsin B
9	9606.ENSP00000262209	0.924	Transient receptor potential cation channel subfamily A member 1
10	9606.ENSP00000340305	0.924	Ubiquitin-conjugating enzyme E2 variant 1
11	9606.ENSP00000345344	0.916	Cathepsin L1
12	9606.ENSP00000376911	0.916	Legumain
13	9606.ENSP00000271651	0.914	Cathepsin K
14	9606.ENSP00000312082	0.897	Toll-like receptor 8
15	9606.ENSP00000390651	0.890	Interleukin-1 receptor-associated kinase 4
16	9606.ENSP00000276927	0.865	Interferon alpha-1/13
17	9606.ENSP00000369213	0.865	Probable ATP-dependent RNA helicase DDX58
18	9606.ENSP00000361359	0.864	Tumor necrosis factor receptor superfamily member 5
19	9606.ENSP00000353874	0.838	Toll-like receptor 9
20	9606.ENSP00000263642	0.835	Interferon-induced helicase C domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003727	0.999	single-stranded RNA binding
GO:0003725	0.993	double-stranded RNA binding
GO:0003677	0.419	DNA binding
GO:0042802	0.312	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.995	positive regulation of biological process
GO:0050896	0.993	response to stimulus
GO:0048583	0.992	regulation of response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0051239	0.987	regulation of multicellular organismal process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0001817	0.983	regulation of cytokine production
GO:0009893	0.977	positive regulation of metabolic process
GO:0007165	0.975	signal transduction
GO:0010604	0.967	positive regulation of macromolecule metabolic process
GO:0006950	0.965	response to stress
GO:0080134	0.965	regulation of response to stress
GO:0048584	0.964	positive regulation of response to stimulus
GO:0032675	0.963	regulation of interleukin-6 production
GO:0009605	0.959	response to external stimulus
GO:0051240	0.955	positive regulation of multicellular organismal process
GO:0031347	0.955	regulation of defense response
GO:0032481	0.953	positive regulation of type I interferon production
GO:0009615	0.949	response to virus
GO:0140546	0.948	defense response to symbiont
GO:0032101	0.939	regulation of response to external stimulus
GO:0002831	0.936	regulation of response to biotic stimulus
GO:0031349	0.932	positive regulation of defense response
GO:0032755	0.920	positive regulation of interleukin-6 production
GO:0032647	0.917	regulation of interferon-alpha production
GO:0002376	0.916	immune system process
GO:0048522	0.907	positive regulation of cellular process
GO:0032103	0.897	positive regulation of response to external stimulus
GO:0050778	0.889	positive regulation of immune response
GO:0032652	0.879	regulation of interleukin-1 production
GO:0002253	0.879	activation of immune response
GO:0002764	0.877	immune response-regulating signaling pathway
GO:0002218	0.870	activation of innate immune response
GO:0002757	0.866	immune response-activating signaling pathway
GO:0042221	0.839	response to chemical
GO:0032732	0.820	positive regulation of interleukin-1 production
GO:0002758	0.803	innate immune response-activating signaling pathway
GO:0019219	0.795	regulation of nucleobase-containing compound metabolic process
GO:0051607	0.795	defense response to virus
GO:0035556	0.709	intracellular signal transduction
GO:0010033	0.703	response to organic substance
GO:0032649	0.695	regulation of type II interferon production
GO:0023051	0.690	regulation of signaling
GO:0010646	0.690	regulation of cell communication
GO:0032677	0.665	regulation of interleukin-8 production
GO:0009966	0.643	regulation of signal transduction
GO:0006955	0.642	immune response
GO:0032648	0.578	regulation of interferon-beta production
GO:0032729	0.570	positive regulation of type II interferon production
GO:0032757	0.568	positive regulation of interleukin-8 production
GO:0032642	0.547	regulation of chemokine production
GO:0010647	0.536	positive regulation of cell communication
GO:0023056	0.535	positive regulation of signaling
GO:0007249	0.525	I-kappaB kinase/NF-kappaB signaling
GO:0009967	0.525	positive regulation of signal transduction
GO:0032728	0.524	positive regulation of interferon-beta production
GO:0009889	0.497	regulation of biosynthetic process
GO:1902531	0.494	regulation of intracellular signal transduction
GO:0048519	0.493	negative regulation of biological process
GO:0031326	0.476	regulation of cellular biosynthetic process
GO:0010556	0.454	regulation of macromolecule biosynthetic process
GO:0051173	0.443	positive regulation of nitrogen compound metabolic process
GO:0031325	0.430	positive regulation of cellular metabolic process
GO:0071704	0.427	organic substance metabolic process
GO:0051252	0.426	regulation of RNA metabolic process
GO:2001141	0.419	regulation of RNA biosynthetic process
GO:0002221	0.393	pattern recognition receptor signaling pathway
GO:0070887	0.390	cellular response to chemical stimulus
GO:0032722	0.377	positive regulation of chemokine production
GO:0071310	0.357	cellular response to organic substance
GO:0044238	0.348	primary metabolic process
GO:0044237	0.334	cellular metabolic process
GO:0065009	0.331	regulation of molecular function
GO:0051246	0.329	regulation of protein metabolic process
GO:0006355	0.327	regulation of DNA-templated transcription
GO:0006807	0.316	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0031410	0.998	cytoplasmic vesicle
GO:0005768	0.987	endosome
GO:0031090	0.974	organelle membrane
GO:0071944	0.970	cell periphery
GO:0005764	0.965	lysosome
GO:0098588	0.963	bounding membrane of organelle
GO:0005886	0.960	plasma membrane
GO:0005783	0.951	endoplasmic reticulum
GO:0030659	0.951	cytoplasmic vesicle membrane
GO:0032991	0.949	protein-containing complex
GO:0010008	0.915	endosome membrane
GO:0005765	0.703	lysosomal membrane
GO:0036019	0.526	endolysosome
GO:0005794	0.414	Golgi apparatus
GO:0036020	0.321	endolysosome membrane
GO:0031984	0.309	organelle subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]