StarFunc result for job id Q9NYL2

User Input

>input (800 residues)
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVL
SHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
LHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQS
LPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLH
QCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERD
LSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQLVRKGDSSAE
MSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNT
NLPDAEILKMTKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQ
DEVKAVQLAIQTLFTNSDGNPGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSP
FFSHFDGQDSYAAAVRRPQVPIKYQQITPVNQSRSSSPTQYGLTKNFSSLHLNSRDSGFS
SGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKSQHSTPSRGRYPGKFYRVSQS
ALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTKVEYRKKPHRP
SPAKTNKERARGDHRGWRNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ESL4	0.438	0.437	0.000	802	0.920	0.918	Q9ESL4.pdb.gz	M3K20_MOUSE Mitogen-activated protein kinase kinase kinase 20 OS=Mus musculus OX=10090 GN=Map3k20 PE=1 SV=1
2	AFDB:D4Q8H0	0.419	0.727	4.810E-55	455	0.440	0.774	D4Q8H0.pdb.gz	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
3	AFDB:Q7T2V3	0.376	0.302	1.401E-26	1005	0.255	0.203	Q7T2V3.pdb.gz	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
4	AFDB:P42684	0.314	0.215	8.261E-21	1182	0.193	0.130	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
5	AFDB:A0A024R8E2	0.311	0.223	1.400E-20	1130	0.188	0.133	A0A024R8E2.pdb.gz
6	PDB:1k9aB	0.287	0.513	5.697E-19	441	0.101	0.184	1k9aB.pdb.gz
7	AFDB:M9PBJ7	0.303	0.204	3.032E-18	1213	0.176	0.116	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
8	PDB:2h8hA	0.290	0.508	5.499E-18	445	0.106	0.191	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
9	AFDB:A0A0G2K7W4	0.286	0.175	4.234E-17	1348	0.203	0.120	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
10	AFDB:Q9JM52	0.296	0.188	4.463E-17	1308	0.186	0.114	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
11	AFDB:B0V0H4	0.278	0.211	7.972E-17	1071	0.188	0.140	B0V0H4.pdb.gz
12	AFDB:A0A0K3AV08	0.291	0.223	9.338E-17	1059	0.196	0.148	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
13	PDB:2qkwB	0.271	0.678	2.128E-15	292	0.087	0.240	2qkwB.pdb.gz
14	PDB:6b1uA	0.289	0.507	2.493E-15	442	0.122	0.222	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:5ufuA	0.284	0.591	3.245E-15	369	0.095	0.206	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:4rerA	0.282	0.477	4.452E-15	459	0.130	0.227	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5u6yA	0.277	0.469	4.947E-15	459	0.102	0.179	5u6yA.pdb.gz
18	PDB:6lk5A	0.281	0.794	5.497E-15	265	0.077	0.234	6lk5A.pdb.gz
19	PDB:4k2rA	0.273	0.389	6.788E-15	551	0.092	0.134	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
20	PDB:4zhxA	0.286	0.538	7.156E-15	409	0.117	0.230	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4Q8H0	0.0	699	455	0.414	0.727	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
2	Q9ESL4	0.0	1508	802	0.921	0.919	M3K20_MOUSE Mitogen-activated protein kinase kinase kinase 20 OS=Mus musculus OX=10090 GN=Map3k20 PE=1 SV=1
3	Q9NYL2	0.0	1672	800	1.000	1.000	M3K20_HUMAN Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3
4	H2KZW3	1.20e-79	273	745	0.209	0.224	M3K20_CAEEL Mitogen-activated protein kinase kinase kinase zak-1 OS=Caenorhabditis elegans OX=6239 GN=zak-1 PE=2 SV=1
5	D3ZG83	4.03e-66	239	940	0.170	0.145	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
6	Q66L42	4.11e-66	239	940	0.170	0.145	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
7	P80192	3.01e-65	238	1104	0.169	0.122	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
8	A0A0G2JUN9	3.62e-65	238	1078	0.169	0.125	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
9	F1LRA7	3.83e-65	238	1100	0.169	0.123	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
10	Q02779	1.01e-64	235	954	0.168	0.140	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
11	Q80XI6	7.15e-63	229	850	0.168	0.158	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
12	Q66HA1	7.58e-63	228	850	0.168	0.158	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
13	Q16584	8.55e-63	228	847	0.166	0.157	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
14	Q7T2V3	3.76e-61	225	1005	0.161	0.128	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
15	Q5TCX8	3.91e-61	226	1036	0.168	0.129	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
16	Q12852	3.78e-60	221	859	0.152	0.142	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
17	Q60700	5.99e-60	221	888	0.152	0.137	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
18	Q8S9K4	7.80e-59	218	880	0.141	0.128	Q8S9K4_ARATH AT5g11850/F14F18_20 OS=Arabidopsis thaliana OX=3702 GN=MKD1 PE=1 SV=1
19	Q1HKZ5	2.32e-56	211	959	0.139	0.116	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
20	O43283	4.93e-56	210	966	0.139	0.115	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	7.4	17.2	ABC1 atypical kinase-like domain
2	PF00069 Pkinase	1.1e-51	187.3	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.5e-59	212.9	Protein tyrosine and serine/threonine kinase
4	PF00536 SAM_1	2.8e-07	42.2	SAM domain (Sterile alpha motif)
5	PF07647 SAM_2	2e-06	39.2	SAM domain (Sterile alpha motif)
6	PF18017 SAM_4	2.5e+02	13.2	SAM domain (Sterile alpha motif)
7	PF02198 SAM_PNT	6.3	18.2	Sterile alpha motif (SAM)/Pointed domain
8	PF09235 SAM_Ste50p	72	15.1	Ste50p, sterile alpha motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343325	0.956	Serine/threonine-protein kinase N1
2	9606.ENSP00000468348	0.935	Dual specificity mitogen-activated protein kinase kinase 6
3	9606.ENSP00000381070	0.913	Dual specificity mitogen-activated protein kinase kinase 7
4	9606.ENSP00000441838	0.876	Zinc finger protein 567
5	9606.ENSP00000304268	0.795	Zinc finger protein 33A
6	9606.ENSP00000354453	0.754	Zinc finger protein 2 homolog
7	9606.ENSP00000372295	0.708	Gap junction beta-2 protein
8	9606.ENSP00000369604	0.691	F-box only protein 16
9	9606.ENSP00000451998	0.684	Echinoderm microtubule-associated protein-like 5
10	9606.ENSP00000282878	0.680	Ras-related protein Rab-3C
11	9606.ENSP00000345064	0.592	Prickle-like protein 1
12	9606.ENSP00000240617	0.530	Phospholipase B-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000287	1.000	magnesium ion binding
GO:0004709	1.000	MAP kinase kinase kinase activity
GO:0005524	1.000	ATP binding
GO:0019899	0.409	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0060173	0.988	limb development
GO:0035113	0.988	embryonic appendage morphogenesis
GO:0044237	0.985	cellular metabolic process
GO:0031098	0.985	stress-activated protein kinase signaling cascade
GO:0007254	0.974	JNK cascade
GO:0071704	0.968	organic substance metabolic process
GO:0044238	0.965	primary metabolic process
GO:0016310	0.962	phosphorylation
GO:0043412	0.957	macromolecule modification
GO:0042733	0.955	embryonic digit morphogenesis
GO:0019538	0.952	protein metabolic process
GO:0006468	0.931	protein phosphorylation
GO:0048583	0.807	regulation of response to stimulus
GO:0048518	0.711	positive regulation of biological process
GO:0009966	0.708	regulation of signal transduction
GO:0048522	0.613	positive regulation of cellular process
GO:1902531	0.447	regulation of intracellular signal transduction
GO:0019222	0.400	regulation of metabolic process
GO:0031323	0.359	regulation of cellular metabolic process
GO:0048584	0.308	positive regulation of response to stimulus
GO:0080090	0.304	regulation of primary metabolic process
GO:0060255	0.304	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.987	cytosol
GO:0043227	0.981	membrane-bounded organelle
GO:0043229	0.975	intracellular organelle
GO:0005634	0.968	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.25	1.000	mitogen-activated protein kinase kinase kinase.

[back to server]