StarFunc result for job id Q9NYP3

User Input

>input (566 residues)
MALSVPGYSPGFRKPPEVVRLRRKRARSRGAAASPPRELTEPAARRAALVAGLPLRPFPA
AGGRGGGSGGGPAAARRNPFARLDNRPRVAAEPPDGPAREQPEAPVPFLDSNQENDLLWE
EKFPERTTVTELPQTSHVSFSEPDIPSSKSTELPVDWSIKTRLLFTSSQPFTWADHLKAQ
EEAQGLVQHCRATEVTLPKSIQDPKLSSELRCTFQQSLIYWLHPALSWLPLFPRIGADRK
MAGKTSPWSNDATLQHVLMSDWSVSFTSLYNLLKTKLCPYFYVCTYQFTVLFRAAGLAGS
DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEEQAISDEDEEE
SFSWLEEMGVQDKIKKPDILSIKLRKEKHEVQMDHRPESVVLVKGINTFTLLNFLINSKS
LVATSGPQAGLPPTLLSPVAFRGATMQMLKARSVNVKTQALSGYRDQFSLEITGPIMPHS
LHSLTMLLKSSQSGSFSAVLYPHEPTAVFNICLQMDKVLDMEVVHKELTNCGLHPNTLEQ
LSQIPLLGKSSLRNVVLRDYIYNWRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYP3	1.000	1.000	6.280E-102	566	1.000	1.000	Q9NYP3.pdb.gz	DONS_HUMAN Protein downstream neighbor of Son OS=Homo sapiens OX=9606 GN=DONSON PE=1 SV=2
2	AFDB:Q9VNA8	0.581	0.579	8.995E-38	568	0.293	0.292	Q9VNA8.pdb.gz	DONS_DROME Protein downstream neighbor of son homolog OS=Drosophila melanogaster OX=7227 GN=hd PE=1 SV=1
3	PDB:6ahrL	0.241	0.348	1.003E-4	362	0.083	0.130	6ahrL.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
4	PDB:7mqaSI	0.065	0.053	3.721E-1	803	0.065	0.046	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:6aggZ	0.079	0.102	6.034E-1	420	0.025	0.033	6aggZ.pdb.gz	Structure of tRNA-Modifying Enzyme TiaS and Motions of Its Substrate Binding Zinc Ribbon.
6	PDB:7d58A	0.070	0.033	8.788E-1	1387	0.067	0.027	7d58A.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
7	AFDB:O14340	0.063	0.035	9.007E-1	1310	0.080	0.034	O14340.pdb.gz	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
8	AFDB:Q14692	0.064	0.035	1.178	1282	0.129	0.057	Q14692.pdb.gz	BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1
9	AFDB:Q8MSV2	0.041	0.040	1.312	590	0.099	0.095	Q8MSV2.pdb.gz	SHEP_DROME Protein alan shepard OS=Drosophila melanogaster OX=7227 GN=shep PE=1 SV=2
10	PDB:1i7qA	0.076	0.079	1.504	517	0.076	0.083	1i7qA.pdb.gz	The structures of anthranilate synthase of Serratia marcescens crystallized in the presence of (i) its substrates, chorismate and glutamine, and a product, glutamate, and (ii) its end-product inhibitor, L-tryptophan.
11	PDB:6o6cA	0.067	0.032	1.674	1446	0.025	0.010	6o6cA.pdb.gz	3.1 angstrom structure of yeast RNA polymerase II elongation complex stalled at a cyclobutane pyrimidine dimer lesion solved using streptavidin affinity grids.
12	PDB:6wm2R	0.056	0.045	1.767	753	0.057	0.042	6wm2R.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
13	PDB:3o3uN	0.040	0.039	1.864	580	0.012	0.012	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
14	AFDB:Q9SJK3	0.042	0.026	2.016	997	0.048	0.027	Q9SJK3.pdb.gz	AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana OX=3702 GN=AGO5 PE=1 SV=2
15	PDB:3kgdB	0.054	0.082	2.311	342	0.028	0.047	3kgdB.pdb.gz	Structure of the RNA 3'-phosphate cyclase-adenylate intermediate illuminates nucleotide specificity and covalent nucleotidyl transfer.
16	PDB:4c3hA	0.073	0.038	2.311	1523	0.069	0.026	4c3hA.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
17	AFDB:B3DH54	0.086	0.072	3.841	708	0.092	0.073	B3DH54.pdb.gz
18	AFDB:Q17R60	0.062	0.046	5.302	797	0.046	0.033	Q17R60.pdb.gz	IMPG1_HUMAN Interphotoreceptor matrix proteoglycan 1 OS=Homo sapiens OX=9606 GN=IMPG1 PE=1 SV=2
19	AFDB:Q9UW20	0.060	0.044	5.302	977	0.072	0.042	Q9UW20.pdb.gz	PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIKALPHA PE=3 SV=1
20	AFDB:Q63475	0.047	0.029	6.229	1004	0.062	0.035	Q63475.pdb.gz	PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus OX=10116 GN=Ptprn2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NYP3	0.0	1163	566	1.000	1.000	DONS_HUMAN Protein downstream neighbor of Son OS=Homo sapiens OX=9606 GN=DONSON PE=1 SV=2
2	Q9VNA8	1.67e-57	204	568	0.276	0.275	DONS_DROME Protein downstream neighbor of son homolog OS=Drosophila melanogaster OX=7227 GN=hd PE=1 SV=1
3	Q9LZW9	0.43	36.2	1336	0.035	0.015	RTOR2_ARATH Regulatory-associated protein of TOR 2 OS=Arabidopsis thaliana OX=3702 GN=RAPTOR2 PE=2 SV=2
4	F1RCH4	0.80	35.4	2475	0.046	0.011	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
5	E7EKH3	2.5	30.8	75	0.025	0.187	B2SN1_SYLSP Brevinin-2SN1 OS=Sylvirana spinulosa OX=369515 PE=1 SV=1
6	Q9QXH4	4.8	32.7	1169	0.057	0.027	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
7	C3RT23	5.7	29.6	75	0.023	0.173	RUG1_LIMKU Rugosin-LK1 OS=Limnonectes kuhlii OX=110107 PE=1 SV=1
8	F4JEG0	6.2	32.0	271	0.032	0.066	F4JEG0_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At3g07460 PE=1 SV=1
9	Q64FW2	8.2	32.0	609	0.027	0.025	RETST_MOUSE All-trans-retinol 13,14-reductase OS=Mus musculus OX=10090 GN=Retsat PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307143

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480987	0.957	DNA replication licensing factor MCM3
2	9606.ENSP00000406046	0.946	DNA polymerase delta catalytic subunit
3	9606.ENSP00000265465	0.928	DNA polymerase alpha subunit B
4	9606.ENSP00000371253	0.922	Trifunctional purine biosynthetic protein adenosine-3
5	9606.ENSP00000368349	0.920	DNA polymerase alpha catalytic subunit
6	9606.ENSP00000223129	0.916	Replication protein A 14 kDa subunit
7	9606.ENSP00000480186	0.910	DNA polymerase delta subunit 2
8	9606.ENSP00000368458	0.908	Proliferating cell nuclear antigen
9	9606.ENSP00000263681	0.906	DNA polymerase delta subunit 3
10	9606.ENSP00000363017	0.904	Replication protein A 32 kDa subunit
11	9606.ENSP00000254719	0.903	Replication protein A 70 kDa DNA-binding subunit
12	9606.ENSP00000362131	0.902	Replication protein A 30 kDa subunit
13	9606.ENSP00000315700	0.792	Chromatin assembly factor 1 subunit B
14	9606.ENSP00000348984	0.788	Protein SON
15	9606.ENSP00000376272	0.767	Replication factor C subunit 4
16	9606.ENSP00000296509	0.760	Mitotic spindle assembly checkpoint protein MAD2A
17	9606.ENSP00000484105	0.749	DNA primase large subunit
18	9606.ENSP00000370966	0.745	Quinone oxidoreductase-like protein 1
19	9606.ENSP00000265056	0.743	DNA replication licensing factor MCM2
20	9606.ENSP00000439768	0.733	Belongs to the UPF0220 family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1903047	0.986	mitotic cell cycle process
GO:0010564	0.986	regulation of cell cycle process
GO:0006974	0.986	cellular response to DNA damage stimulus
GO:0006261	0.985	DNA-templated DNA replication
GO:0048523	0.974	negative regulation of cellular process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:1901987	0.960	regulation of cell cycle phase transition
GO:0007346	0.957	regulation of mitotic cell cycle
GO:0051052	0.957	regulation of DNA metabolic process
GO:1901990	0.954	regulation of mitotic cell cycle phase transition
GO:0000075	0.951	cell cycle checkpoint signaling
GO:0051172	0.914	negative regulation of nitrogen compound metabolic process
GO:0010605	0.913	negative regulation of macromolecule metabolic process
GO:1901991	0.901	negative regulation of mitotic cell cycle phase transition
GO:0007093	0.901	mitotic cell cycle checkpoint signaling
GO:0090329	0.895	regulation of DNA-templated DNA replication
GO:0031570	0.893	DNA integrity checkpoint signaling
GO:0010389	0.885	regulation of G2/M transition of mitotic cell cycle
GO:0000077	0.877	DNA damage checkpoint signaling
GO:0051053	0.873	negative regulation of DNA metabolic process
GO:0044773	0.854	mitotic DNA damage checkpoint signaling
GO:0007095	0.817	mitotic G2 DNA damage checkpoint signaling
GO:0008156	0.815	negative regulation of DNA replication
GO:0045005	0.795	DNA-templated DNA replication maintenance of fidelity
GO:2000104	0.723	negative regulation of DNA-templated DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032993	0.998	protein-DNA complex
GO:0005657	0.997	replication fork
GO:0030894	0.991	replisome
GO:0005654	0.955	nucleoplasm
GO:0005737	0.758	cytoplasm
GO:0005829	0.492	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]