StarFunc result for job id Q9NYP8

User Input

>input (219 residues)
MAPPSRHCLLLISTLGVFALNCFTKGQKNSTLIFTRENTIRNCSCSADIRDCDYSLANLM
CNCKTVLPLAVERTSYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAIC
GLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMYISFLDMALFNRDSA
FKSYSIENVTSIANNFPDFSYFRTFPMPSNKSYVVTFIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4yduC	0.200	0.193	3.016E-1	230	0.055	0.052	4yduC.pdb.gz	The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
2	AFDB:Q54PQ2	0.191	0.055	4.286E-1	944	0.082	0.019	Q54PQ2.pdb.gz	Q54PQ2_DICDI Actin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=fia PE=3 SV=1
3	PDB:4crnX	0.133	0.081	7.634E-1	421	0.055	0.029	4crnX.pdb.gz	Cryoelectron Microscopic Structures of Eukaryotic Translation Termination Complexes Containing Erf1-Erf3 or Erf1-Abce1.
4	AFDB:O80612	0.100	0.049	8.469E-1	555	0.091	0.036	O80612.pdb.gz	APY6_ARATH Probable apyrase 6 OS=Arabidopsis thaliana OX=3702 GN=APY6 PE=2 SV=2
5	AFDB:Q8IFJ1	0.206	0.081	8.469E-1	685	0.064	0.020	Q8IFJ1.pdb.gz	Q8IFJ1_TRYB2 Retrotransposon hot spot (RHS) protein, putative retrotransposon hot spot protein 4 (RHS4), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.70 PE=4 SV=1
6	AFDB:Q9SH31	0.118	0.050	8.469E-1	664	0.050	0.017	Q9SH31.pdb.gz	GT16_ARATH Xyloglucan-specific galacturonosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GT16 PE=2 SV=1
7	AFDB:Q9TZ27	0.157	0.116	8.469E-1	316	0.087	0.060	Q9TZ27.pdb.gz	Q9TZ27_CAEEL F-box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fbxa-59 PE=1 SV=2
8	PDB:5z62B	0.097	0.094	8.640E-1	227	0.037	0.035	5z62B.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
9	AFDB:Q4QNA6	0.163	0.138	9.585E-1	265	0.041	0.034	Q4QNA6.pdb.gz	Q4QNA6_HAEI8 Competence protein A OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=comA PE=4 SV=1
10	PDB:3godA	0.116	0.085	9.779E-1	320	0.023	0.016	3godA.pdb.gz	Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
11	AFDB:O25533	0.208	0.205	1.020	223	0.032	0.031	O25533.pdb.gz	COAX_HELPY Type III pantothenate kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=coaX PE=1 SV=1
12	PDB:4a2bA	0.154	0.094	1.107	386	0.046	0.026	4a2bA.pdb.gz	Ftsa Forms Actin-Like Protofilaments
13	PDB:7uq0B	0.166	0.133	1.107	307	0.050	0.036	7uq0B.pdb.gz
14	AFDB:O45285	0.195	0.123	1.306	377	0.050	0.029	O45285.pdb.gz	O45285_CAEEL F-box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fbxa-167 PE=1 SV=1
15	AFDB:Q08DF7	0.119	0.056	1.306	609	0.041	0.015	Q08DF7.pdb.gz	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1
16	PDB:1ig8A	0.163	0.091	1.418	469	0.064	0.030	1ig8A.pdb.gz
17	PDB:3htvA	0.142	0.116	1.418	279	0.041	0.032	3htvA.pdb.gz
18	AFDB:Q38C43	0.257	0.118	1.478	558	0.059	0.023	Q38C43.pdb.gz	Q38C43_TRYB2 Actin-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5830 PE=3 SV=1
19	PDB:5ts5A	0.093	0.048	1.605	483	0.018	0.008	5ts5A.pdb.gz	Crystal structure and molecular dynamics studies of L-amino acid oxidase from Bothrops atrox.
20	PDB:5huxA	0.124	0.071	1.816	429	0.041	0.021	5huxA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4I460	1.6	32.3	1500	0.068	0.010	MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana OX=3702 GN=XI-B PE=3 SV=1
2	Q21540	2.2	31.6	572	0.078	0.030	CUT6_CAEEL Cuticlin-6 OS=Caenorhabditis elegans OX=6239 GN=cut-6 PE=1 SV=2
3	O48709	3.7	31.2	705	0.146	0.045	PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=PIP5K3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15137 DUF4571	2.3e-113	388.8	Domain of unknown function (DUF4571)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444950

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328992	0.649	PAX3- and PAX7-binding protein 1
2	9606.ENSP00000371253	0.642	Trifunctional purine biosynthetic protein adenosine-3
3	9606.ENSP00000242505	0.564	Protein FAM149B1
4	9606.ENSP00000278855	0.564	Oocyte secreted protein 2
5	9606.ENSP00000371785	0.560	Oligodendrocyte transcription factor 1
6	9606.ENSP00000400736	0.560	Uncharacterized protein C1orf159
7	9606.ENSP00000409667	0.529	Synaptojanin-1
8	9606.ENSP00000254579	0.504	Dynein heavy chain domain 1
9	9606.ENSP00000370013	0.504	Pentatricopeptide repeat-containing protein 2, mitochondrial
10	9606.ENSP00000308548	0.503	Zinc finger HIT-type containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.513	organic cyclic compound binding
GO:0003824	0.496	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.938	regulation of cellular process
GO:0050896	0.675	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.973	intracellular anatomical structure
GO:0043226	0.877	organelle
GO:0043227	0.743	membrane-bounded organelle
GO:0005737	0.684	cytoplasm
GO:0043229	0.586	intracellular organelle
GO:0071944	0.534	cell periphery
GO:0005886	0.349	plasma membrane
GO:0043231	0.329	intracellular membrane-bounded organelle
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]