StarFunc result for job id Q9NYP9

User Input

>input (233 residues)
MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDAS
VADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVD
KEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGS
SEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYP9	1.000	1.000	4.693E-39	233	1.000	1.000	Q9NYP9.pdb.gz	MS18A_HUMAN Protein Mis18-alpha OS=Homo sapiens OX=9606 GN=MIS18A PE=1 SV=1
2	AFDB:Q9CZJ6	0.518	0.588	6.782E-25	204	0.652	0.745	Q9CZJ6.pdb.gz	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
3	AFDB:Q9P802	0.413	0.492	3.822E-10	194	0.176	0.211	Q9P802.pdb.gz	MIS18_SCHPO Kinetochore protein mis18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis18 PE=1 SV=2
4	AFDB:A0A024R9N0	0.426	0.433	6.367E-10	229	0.150	0.153	A0A024R9N0.pdb.gz
5	AFDB:A2AQ14	0.426	0.412	9.683E-9	241	0.124	0.120	A2AQ14.pdb.gz	MS18B_MOUSE Protein Mis18-beta OS=Mus musculus OX=10090 GN=Oip5 PE=2 SV=1
6	PDB:6symA	0.327	0.536	2.244E-4	135	0.086	0.148	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
7	AFDB:Q9Y3D2	0.305	0.385	5.178E-4	182	0.120	0.154	Q9Y3D2.pdb.gz	MSRB2_HUMAN Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2
8	PDB:5fqdE	0.342	0.229	1.162E-3	367	0.056	0.035	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
9	PDB:6h0gB	0.341	0.210	1.633E-3	401	0.073	0.042	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
10	PDB:6h61A	0.269	0.106	1.935E-3	660	0.103	0.036	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
11	AFDB:Q96C10	0.318	0.118	3.560E-3	678	0.090	0.031	Q96C10.pdb.gz	DHX58_HUMAN ATP-dependent RNA helicase DHX58 OS=Homo sapiens OX=9606 GN=DHX58 PE=1 SV=1
12	AFDB:D3TI84	0.331	0.092	8.820E-3	933	0.052	0.013	D3TI84.pdb.gz	D3TI84_ANAPL RNA helicase OS=Anas platyrhynchos OX=8839 GN=RIG-I PE=1 SV=1
13	PDB:7bkpA	0.300	0.112	8.947E-3	689	0.107	0.036	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
14	PDB:7tnxA	0.313	0.122	1.490E-2	647	0.086	0.031	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
15	PDB:6n8mY	0.229	0.394	1.767E-2	128	0.086	0.156	6n8mY.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
16	PDB:2kv1A	0.286	0.472	4.633E-2	124	0.086	0.161	2kv1A.pdb.gz
17	PDB:8dvsA	0.310	0.116	5.812E-2	682	0.064	0.022	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
18	AFDB:Q96326	0.137	0.129	1.885E-1	256	0.137	0.125	Q96326.pdb.gz	CCME_ARATH Cytochrome c-type biogenesis protein CcmE homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CCME PE=1 SV=1
19	PDB:4xgtA	0.123	0.042	2.539E-1	961	0.124	0.030	4xgtA.pdb.gz
20	AFDB:Q57ZB7	0.158	0.097	4.670E-1	438	0.099	0.053	Q57ZB7.pdb.gz	Q57ZB7_TRYB2 TPM domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.840 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NYP9	1.13e-167	463	233	1.000	1.000	MS18A_HUMAN Protein Mis18-alpha OS=Homo sapiens OX=9606 GN=MIS18A PE=1 SV=1
2	Q9CZJ6	1.63e-100	292	204	0.670	0.765	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
3	Q9P802	1.26e-10	60.8	194	0.185	0.222	MIS18_SCHPO Kinetochore protein mis18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis18 PE=1 SV=2
4	O43482	0.002	40.4	229	0.219	0.223	MS18B_HUMAN Protein Mis18-beta OS=Homo sapiens OX=9606 GN=OIP5 PE=1 SV=2
5	A0A0B4J1S8	1.7	32.3	828	0.077	0.022	A0A0B4J1S8_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1
6	O02810	1.7	32.3	816	0.077	0.022	PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus OX=9913 GN=PI4KB PE=1 SV=2
7	Q9UBF8	1.8	32.3	816	0.077	0.022	PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1
8	Q9FFK6	2.2	32.0	810	0.172	0.049	NUP88_ARATH Nuclear pore complex protein NUP88 OS=Arabidopsis thaliana OX=3702 GN=NUP88 PE=1 SV=1
9	O08561	2.8	31.6	816	0.077	0.022	PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus OX=10116 GN=Pi4kb PE=1 SV=1
10	Q2M3M2	3.4	31.2	681	0.099	0.034	SC5A9_HUMAN Sodium/glucose cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC5A9 PE=1 SV=2
11	Q5KUG0	4.5	30.8	1086	0.077	0.017	ICMF_GEOKA Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=icmF PE=1 SV=1
12	U2WQ53	4.5	30.8	1086	0.077	0.017	U2WQ53_GEOKU Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus GBlys OX=1337888 GN=icmF PE=3 SV=1
13	G5EFL5	5.8	30.8	1424	0.086	0.014	G5EFL5_CAEEL PDZ and LIM domain protein Zasp OS=Caenorhabditis elegans OX=6239 GN=alp-1 PE=1 SV=1
14	Q9JLQ2	6.4	30.4	708	0.112	0.037	GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus OX=10090 GN=Git2 PE=1 SV=2
15	A0A0G2K2C4	8.4	30.0	679	0.082	0.028	A0A0G2K2C4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1
16	G5EEF6	9.2	30.0	771	0.086	0.026	G5EEF6_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=alp-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11067 DUF2868	71	14.2	Protein of unknown function (DUF2868)
2	PF08295 Sin3_corepress	70	14.9	Sin3 family co-repressor
3	PF03226 Yippee-Mis18	3.3e-26	102.9	Yippee zinc-binding/DNA-binding /Mis18, centromere assembly

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220514	0.999	Protein Mis18-beta
2	9606.ENSP00000309790	0.999	Mis18-binding protein 1
3	9606.ENSP00000414109	0.994	Holliday junction recognition protein
4	9606.ENSP00000336868	0.966	Histone H3-like centromeric protein A
5	9606.ENSP00000369424	0.922	Histone-binding protein RBBP7
6	9606.ENSP00000362018	0.896	Centromere protein I
7	9606.ENSP00000362592	0.879	Histone-binding protein RBBP4
8	9606.ENSP00000283006	0.842	Centromere protein H
9	9606.ENSP00000457810	0.837	Centromere protein T
10	9606.ENSP00000273853	0.835	Centromere protein C
11	9606.ENSP00000308583	0.825	Centromere protein S
12	9606.ENSP00000377007	0.820	Centromere protein N
13	9606.ENSP00000357308	0.797	Constitutive centromere associated network
14	9606.ENSP00000328547	0.790	DNA (cytosine-5)-methyltransferase 3B
15	9606.ENSP00000311513	0.772	Remodeling and spacing factor 1
16	9606.ENSP00000281453	0.771	Centromere protein U
17	9606.ENSP00000370214	0.766	Centromere protein O
18	9606.ENSP00000337289	0.755	Centromere protein Q
19	9606.ENSP00000360133	0.735	Centromere protein R
20	9606.ENSP00000379911	0.735	Centromere protein K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.996	cellular component organization
GO:0050789	0.993	regulation of biological process
GO:0065004	0.991	protein-DNA complex assembly
GO:0006325	0.988	chromatin organization
GO:0051276	0.986	chromosome organization
GO:0050794	0.982	regulation of cellular process
GO:0022402	0.980	cell cycle process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0006338	0.964	chromatin remodeling
GO:0051171	0.952	regulation of nitrogen compound metabolic process
GO:0007059	0.951	chromosome segregation
GO:0034508	0.943	centromere complex assembly
GO:0031323	0.874	regulation of cellular metabolic process
GO:0019219	0.834	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.627	regulation of DNA metabolic process
GO:0044030	0.319	regulation of DNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0043232	0.951	intracellular non-membrane-bounded organelle
GO:0005694	0.826	chromosome
GO:0098687	0.738	chromosomal region
GO:0000775	0.570	chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]