StarFunc result for job id Q9NYQ6

User Input

>input (1400 residues)
MAPPPPPVLPVLLLLAAAAALPAMGLRAAAWEPRVPGGTRAFALRPGCTYAVGAACTPRA
PRELLDVGRDGRLAGRRRVSGAGRPLPLQVRLVARSAPTALSRRLRARTHLPGCGARARL
CGTGARLCGALCFPVPGGCAAAQHSALAAPTTLPACRCPPRPRPRCPGRPICLPPGGSVR
LRLLCALRRAAGAVRVGLALEAATAGTPSASPSPSPPLPPNLPEARAGPARRARRGTSGR
GSLKFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDS
ATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRE
RVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWDVFQLNESSGVVSTRAVLDREEA
AEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLR
VQATDRDQGQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGG
RPPLINSSGVVSVQVLDVNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARL
HYRLVDTASTFLGGGSAGPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAV
DHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDANSVI
TYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRSHTAHVLINVT
DANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRIDPD
SGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGS
IFEDAPPSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDREN
VAVYNLWALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAK
IRANDPDEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEVRREYVLVVQATSAP
LVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSNSFPTGVIGCIPAHDPDVSDSLNY
TFVQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRVTIITD
DMLTNSITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNV
TFSALLPGGVRGQFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVS
VLRFDSSAPFLSSTTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSDPCGANGRCRS
REGGYTCECFEDFTGEHCEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95206	0.205	0.258	1.474E-45	1070	0.140	0.183	O95206.pdb.gz	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
2	AFDB:Q91Y12	0.201	0.286	1.699E-45	946	0.138	0.204	Q91Y12.pdb.gz	Q91Y12_MOUSE Protocadherin alpha 8 OS=Mus musculus OX=10090 GN=Pcdha8 PE=2 SV=1
3	AFDB:Q9Y5I3	0.203	0.288	1.781E-45	950	0.139	0.205	Q9Y5I3.pdb.gz	PCDA1_HUMAN Protocadherin alpha-1 OS=Homo sapiens OX=9606 GN=PCDHA1 PE=2 SV=1
4	AFDB:Q9UN74	0.204	0.288	2.999E-45	947	0.136	0.202	Q9UN74.pdb.gz	PCDA4_HUMAN Protocadherin alpha-4 OS=Homo sapiens OX=9606 GN=PCDHA4 PE=1 SV=1
5	AFDB:Q91Y11	0.214	0.294	4.380E-45	979	0.134	0.192	Q91Y11.pdb.gz	PCDA9_MOUSE Protocadherin alpha-9 OS=Mus musculus OX=10090 GN=Pcdha9 PE=2 SV=1
6	AFDB:O88689	0.218	0.306	5.819E-45	947	0.137	0.203	O88689.pdb.gz	PCDA4_MOUSE Protocadherin alpha-4 OS=Mus musculus OX=10090 GN=Pcdha4 PE=1 SV=1
7	AFDB:Q9Y5H9	0.163	0.227	6.102E-45	948	0.145	0.214	Q9Y5H9.pdb.gz	PCDA2_HUMAN Protocadherin alpha-2 OS=Homo sapiens OX=9606 GN=PCDHA2 PE=1 SV=1
8	AFDB:Q91Y17	0.168	0.236	7.033E-45	948	0.138	0.204	Q91Y17.pdb.gz	Q91Y17_MOUSE Protocadherin alpha 2 OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
9	AFDB:Q9UN73	0.213	0.302	9.797E-45	950	0.133	0.196	Q9UN73.pdb.gz	PCDA6_HUMAN Protocadherin alpha-6 OS=Homo sapiens OX=9606 GN=PCDHA6 PE=2 SV=1
10	AFDB:Q9UN72	0.164	0.231	1.649E-44	937	0.141	0.210	Q9UN72.pdb.gz	PCDA7_HUMAN Protocadherin alpha-7 OS=Homo sapiens OX=9606 GN=PCDHA7 PE=2 SV=1
11	PDB:7sqcO0	0.104	0.123	3.072E-19	1140	0.076	0.094	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.126	0.767	1.432E-14	209	0.047	0.316	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:5oj2B	0.084	0.143	2.299E-14	692	0.071	0.145	5oj2B.pdb.gz
14	PDB:4aq1A	0.085	0.137	2.454E-13	721	0.061	0.118	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
15	PDB:1e07A	0.103	0.166	5.082E-12	642	0.060	0.131	1e07A.pdb.gz
16	PDB:5a42A	0.065	0.060	5.688E-11	1597	0.093	0.081	5a42A.pdb.gz
17	PDB:7vonA	0.068	0.068	2.846E-10	1399	0.071	0.071	7vonA.pdb.gz
18	PDB:7nycA	0.069	0.065	1.641E-9	1542	0.066	0.060	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7q1yA	0.070	0.071	1.983E-9	1374	0.063	0.064	7q1yA.pdb.gz
20	PDB:7q5zA	0.071	0.073	1.040E-8	1344	0.069	0.071	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PRU0	0.0	2852	3019	1.000	0.464	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
2	A0JBX1	0.0	1576	2941	0.549	0.261	A0JBX1_DANRE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Danio rerio OX=7955 GN=off-road PE=1 SV=1
3	F1QBS8	0.0	1665	3006	0.597	0.278	F1QBS8_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Danio rerio OX=7955 GN=celsr1b PE=3 SV=1
4	F1R9W4	0.0	1652	3044	0.574	0.264	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
5	O35161	0.0	2219	3034	0.809	0.373	CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3
6	Q91ZI0	0.0	1428	3301	0.506	0.214	CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus OX=10090 GN=Celsr3 PE=2 SV=2
7	Q9NYQ6	0.0	2852	3014	1.000	0.464	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
8	Q9NYQ7	0.0	1444	3312	0.509	0.215	CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens OX=9606 GN=CELSR3 PE=1 SV=2
9	Q9QYP2	0.0	785	2144	0.277	0.181	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
10	Q9R0M0	0.0	1558	2919	0.551	0.264	CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus OX=10090 GN=Celsr2 PE=1 SV=3
11	Q9V5N8	0.0	1038	3579	0.408	0.160	STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4
12	G5EDK5	3.71e-167	558	2596	0.271	0.146	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
13	Q80Z62	4.22e-166	502	335	0.173	0.722	Q80Z62_RAT Flamingo-like protein celsr2 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
14	Q6V0I7	1.05e-131	454	4981	0.239	0.067	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
15	Q2PZL6	1.64e-130	450	4981	0.239	0.067	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
16	A2BGT8	2.43e-128	444	4611	0.233	0.071	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
17	Q14517	4.08e-125	434	4588	0.229	0.070	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
18	Q9VW71	8.66e-124	430	4699	0.246	0.073	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
19	Q9WU10	2.01e-123	429	4589	0.255	0.078	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
20	A0A1L1SQU7	2.10e-122	426	4645	0.217	0.065	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	3.7e-164	545.1	Cadherin domain
2	PF08266 Cadherin_2	7.1e-05	33.9	Cadherin-like
3	PF16184 Cadherin_3	8.4e-16	69.3	Cadherin-like
4	PF17803 Cadherin_4	4.9e-05	35.2	Bacterial cadherin-like domain
5	PF08758 Cadherin_pro	0.0016	29.9	Cadherin prodomain like
6	PF00008 EGF	0.68	21.6	EGF-like domain
7	PF07974 EGF_2	3.3	19.4	EGF-like domain
8	PF12947 EGF_3	2e+02	13.6	EGF domain
9	PF17756 RET_CLD1	0.0067	28.2	RET Cadherin like domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262738

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351605	0.929	Frizzled-6
2	9606.ENSP00000357040	0.929	Vang-like protein 2
3	9606.ENSP00000347672	0.890	VANGL planar cell polarity protein 1
4	9606.ENSP00000437489	0.829	Frizzled-3
5	9606.ENSP00000295902	0.817	Prickle planar cell polarity protein 2
6	9606.ENSP00000005340	0.787	Segment polarity protein dishevelled homolog DVL-2
7	9606.ENSP00000345064	0.775	Prickle-like protein 1
8	9606.ENSP00000430985	0.766	Ankyrin repeat domain-containing protein 6
9	9606.ENSP00000368169	0.763	Segment polarity protein dishevelled homolog DVL-1
10	9606.ENSP00000345785	0.728	Frizzled-9
11	9606.ENSP00000357177	0.721	Rho guanine nucleotide exchange factor 11
12	9606.ENSP00000316054	0.718	Segment polarity protein dishevelled homolog DVL-3
13	9606.ENSP00000418754	0.711	Inactive tyrosine-protein kinase 7
14	9606.ENSP00000349486	0.681	Protein scribble homolog
15	9606.ENSP00000470248	0.669	Prickle planar cell polarity protein 3
16	9606.ENSP00000334941	0.666	Receptor-type tyrosine-protein phosphatase U
17	9606.ENSP00000378557	0.655	Disheveled-associated activator of morphogenesis 1
18	9606.ENSP00000323901	0.588	Frizzled-2
19	9606.ENSP00000262457	0.586	Inversin
20	9606.ENSP00000330862	0.584	Opioid-binding protein/cell adhesion molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.970	anatomical structure development
GO:0032501	0.962	multicellular organismal process
GO:0007275	0.921	multicellular organism development
GO:0048731	0.901	system development
GO:0009987	0.872	cellular process
GO:0007399	0.699	nervous system development
GO:0065007	0.515	biological regulation
GO:0050794	0.501	regulation of cellular process
GO:0050896	0.373	response to stimulus
GO:0048513	0.342	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.990	plasma membrane
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0005634	0.876	nucleus
GO:0031974	0.792	membrane-enclosed lumen
GO:0070013	0.774	intracellular organelle lumen
GO:0031981	0.761	nuclear lumen
GO:0005654	0.747	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]