StarFunc result for job id Q9NYQ7

User Input

>input (1400 residues)
MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGPRAHIGGGA
LALCPESSGVREDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGS
RERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
GPKPVSSQRNAGTGSRKRVGTARCCGELWATGSKGQGERATTSGAERTAPRRNCLPGASG
SGPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSRGLFRCRFLPQRPGPRPPGLPA
RPEARKVTSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRL
VYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARA
AAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDEND
NAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTG
EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSV
LENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVE
HYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA
VDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDN
LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ
FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR
TVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENS
IVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVI
VVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP
DVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV
LRVVIITEELLANSLTVRLENMWQERFLSPLLGRFLEGVAAVLATPAEDVFIFNIQNDTD
VGGTVLNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCL
REPCENYMKCVSVLRFDSSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RY69	0.206	0.228	1.685E-58	1237	0.171	0.193	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
2	AFDB:A0A0A6YY83	0.200	0.218	2.887E-56	1255	0.156	0.175	A0A0A6YY83.pdb.gz	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
3	AFDB:Q9BZA7	0.209	0.216	6.921E-56	1347	0.154	0.160	Q9BZA7.pdb.gz	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
4	AFDB:F6ZNL5	0.187	0.194	2.407E-54	1338	0.151	0.158	F6ZNL5.pdb.gz	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
5	AFDB:Q6IS19	0.179	0.237	3.180E-48	1026	0.135	0.184	Q6IS19.pdb.gz
6	AFDB:A0A2R8RMH2	0.189	0.227	5.113E-47	1150	0.132	0.161	A0A2R8RMH2.pdb.gz
7	AFDB:O14917	0.258	0.307	8.123E-47	1159	0.138	0.167	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
8	PDB:7sqcO0	0.115	0.129	3.620E-20	1140	0.074	0.091	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	PDB:4aq1A	0.101	0.160	3.428E-16	721	0.054	0.105	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
10	AFDB:B7YZW3	0.099	0.072	4.445E-16	2064	0.131	0.089	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
11	PDB:6velC	0.121	0.688	1.604E-15	209	0.049	0.330	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:5oj2B	0.100	0.163	6.771E-15	692	0.059	0.118	5oj2B.pdb.gz
13	AFDB:Q9W213	0.122	0.122	1.565E-13	1395	0.079	0.080	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
14	PDB:5a42A	0.080	0.073	8.521E-13	1597	0.097	0.085	5a42A.pdb.gz
15	AFDB:F1R2D2	0.136	0.119	8.996E-13	1687	0.082	0.068	F1R2D2.pdb.gz
16	PDB:1e07A	0.087	0.150	1.751E-12	642	0.052	0.114	1e07A.pdb.gz
17	PDB:7vonA	0.098	0.098	1.236E-11	1399	0.074	0.074	7vonA.pdb.gz
18	PDB:7q1yA	0.080	0.081	2.320E-10	1374	0.072	0.074	7q1yA.pdb.gz
19	PDB:7nycA	0.085	0.080	2.850E-10	1542	0.068	0.062	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:6h03A	0.084	0.090	3.685E-10	1223	0.071	0.081	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PRU0	0.0	1307	3019	0.474	0.220	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
2	A0JBX1	0.0	1439	2941	0.498	0.237	A0JBX1_DANRE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Danio rerio OX=7955 GN=off-road PE=1 SV=1
3	F1QBS8	0.0	1424	3006	0.496	0.231	F1QBS8_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Danio rerio OX=7955 GN=celsr1b PE=3 SV=1
4	F1R9W4	0.0	1418	3044	0.506	0.233	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
5	O35161	0.0	1402	3034	0.502	0.232	CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3
6	Q91ZI0	0.0	2464	3301	0.908	0.385	CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus OX=10090 GN=Celsr3 PE=2 SV=2
7	Q9NYQ6	0.0	1307	3014	0.474	0.220	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
8	Q9NYQ7	0.0	2836	3312	1.000	0.423	CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens OX=9606 GN=CELSR3 PE=1 SV=2
9	Q9QYP2	0.0	660	2144	0.240	0.157	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
10	Q9R0M0	0.0	1464	2919	0.534	0.256	CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus OX=10090 GN=Celsr2 PE=1 SV=3
11	Q9V5N8	0.0	920	3579	0.366	0.143	STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4
12	Q80Z62	2.82e-167	505	335	0.170	0.710	Q80Z62_RAT Flamingo-like protein celsr2 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
13	G5EDK5	2.42e-163	546	2596	0.257	0.139	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
14	Q2PZL6	5.28e-130	449	4981	0.234	0.066	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
15	Q6V0I7	3.98e-125	434	4981	0.228	0.064	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
16	Q14517	8.58e-125	433	4588	0.229	0.070	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
17	Q9WU10	1.24e-122	426	4589	0.226	0.069	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
18	A0A1L1SQU7	5.05e-122	424	4645	0.225	0.068	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
19	A0A087WRT4	5.37e-122	424	4602	0.225	0.068	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
20	F2Z4A3	5.62e-122	424	4590	0.225	0.069	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	1.1e-173	575.6	Cadherin domain
2	PF08266 Cadherin_2	2e-06	38.9	Cadherin-like
3	PF16184 Cadherin_3	4.8e-18	76.5	Cadherin-like
4	PF17803 Cadherin_4	35	16.4	Bacterial cadherin-like domain
5	PF17756 RET_CLD1	0.00025	32.8	RET Cadherin like domain 1
6	PF14292 SusE	7	18.4	SusE outer membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000164024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437489	0.895	Frizzled-3
2	9606.ENSP00000345785	0.865	Frizzled-9
3	9606.ENSP00000357040	0.850	Vang-like protein 2
4	9606.ENSP00000347672	0.816	VANGL planar cell polarity protein 1
5	9606.ENSP00000295902	0.760	Prickle planar cell polarity protein 2
6	9606.ENSP00000215368	0.711	Ephrin-A2
7	9606.ENSP00000369756	0.690	Receptor-type tyrosine-protein phosphatase alpha
8	9606.ENSP00000357909	0.686	Semaphorin-6C
9	9606.ENSP00000430985	0.678	Ankyrin repeat domain-containing protein 6
10	9606.ENSP00000467290	0.671	Semaphorin-6B
11	9606.ENSP00000351605	0.654	Frizzled-6
12	9606.ENSP00000368884	0.649	Ribosomal protein S6 kinase alpha-3
13	9606.ENSP00000268164	0.647	Alpha-2,8-sialyltransferase 8B
14	9606.ENSP00000270077	0.644	Pregnancy specific beta-1-glycoprotein 9
15	9606.ENSP00000368169	0.642	Segment polarity protein dishevelled homolog DVL-1
16	9606.ENSP00000345064	0.628	Prickle-like protein 1
17	9606.ENSP00000470248	0.615	Prickle planar cell polarity protein 3
18	9606.ENSP00000478721	0.607	Tyrosine-protein kinase RYK
19	9606.ENSP00000257414	0.604	Semaphorin-6A
20	9606.ENSP00000413929	0.588	REST corepressor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0004930	0.738	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.965	response to stimulus
GO:0009987	0.963	cellular process
GO:0023052	0.857	signaling
GO:0050794	0.857	regulation of cellular process
GO:0007154	0.815	cell communication
GO:0051716	0.803	cellular response to stimulus
GO:0007165	0.638	signal transduction
GO:0032501	0.592	multicellular organismal process
GO:0032502	0.586	developmental process
GO:0048856	0.577	anatomical structure development
GO:0007275	0.418	multicellular organism development
GO:0048731	0.344	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.810	cell periphery
GO:0005886	0.793	plasma membrane
GO:0005622	0.478	intracellular anatomical structure
GO:0043226	0.465	organelle
GO:0043227	0.438	membrane-bounded organelle
GO:0043231	0.401	intracellular membrane-bounded organelle
GO:0005634	0.358	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]