StarFunc result for job id Q9NYQ8

User Input

>input (1400 residues)
MTIALLGFAIFLLHCATCEKPLEGILSSSAWHFTHSHYNATIYENSSPKTYVESFEKMGI
YLAEPQWAVRYRIISGDVANVFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQ
ATEKTLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQN
AEFYYAFNTRSEMFAIHPTSGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLA
ALVVHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDPGKHF
KAIKSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSL
KFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPNLQYVLKPSSENVGFKLNARTGLITTTKL
MDFHDRAHYQLHIRTSPGQASTVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAV
TATDRDHGENGYVTYSIAGPKALPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGS
PFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQNLKYE
IVSGNELEYFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYASPTTLNITVVK
DPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQ
SIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDY
EATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIA
ELTTKDADSEDNGRVRYTLLSPTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPS
KGHQLFSVTDLIITLEDVNDNSPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEV
RYVLMDGAHGTFRVDLMTGALILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIV
LDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAF
SINQDTGMIQTLAPLDREFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQA
VFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQL
DRENKDEHILEVTVLDNGEPSLKSTSRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVSP
GPVYRLVASDLDEGLNGRVTYSIEDSDEEAFSIDLVTGVVSSSSTFTAGEYNILTIKATD
SGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYYSFTVMETDPVNHMVGVISVEGRPGLF
WFNISGGDKDMDFDIEKTTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VVG0	0.229	0.182	3.745E-79	1820	0.225	0.173	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
2	AFDB:Q99PJ1	0.154	0.116	3.180E-78	1943	0.220	0.159	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
3	AFDB:Q5ICW6	0.135	0.113	3.489E-78	1796	0.230	0.179	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
4	AFDB:A0A0R4IZF0	0.142	0.111	1.776E-77	1907	0.224	0.164	A0A0R4IZF0.pdb.gz
5	AFDB:Q9VFH5	0.144	0.110	4.493E-75	1981	0.240	0.170	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
6	AFDB:Q08C65	0.239	0.387	5.939E-75	847	0.215	0.355	Q08C65.pdb.gz
7	AFDB:Q96QU1	0.174	0.130	1.336E-71	1955	0.216	0.154	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
8	AFDB:Q9VAF5	0.151	0.130	4.689E-71	1706	0.204	0.168	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
9	AFDB:Q0ZM14	0.188	0.153	1.646E-70	1899	0.222	0.164	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
10	AFDB:F1LXN4	0.151	0.139	2.119E-67	1551	0.182	0.164	F1LXN4.pdb.gz	F1LXN4_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=4
11	PDB:7sqcO0	0.108	0.128	6.160E-18	1140	0.096	0.118	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.098	0.476	1.962E-13	209	0.043	0.287	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:1e07A	0.095	0.168	6.416E-12	642	0.060	0.131	1e07A.pdb.gz
14	PDB:4aq1A	0.072	0.115	1.959E-11	721	0.065	0.126	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
15	PDB:5oj2B	0.083	0.150	1.094E-10	692	0.069	0.139	5oj2B.pdb.gz
16	PDB:5a42A	0.084	0.077	4.023E-10	1597	0.087	0.076	5a42A.pdb.gz
17	PDB:7q1yA	0.093	0.094	6.251E-9	1374	0.084	0.086	7q1yA.pdb.gz
18	PDB:7q5zA	0.084	0.086	2.522E-8	1344	0.069	0.071	7q5zA.pdb.gz
19	PDB:7nycA	0.068	0.063	8.065E-8	1542	0.059	0.053	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7vonA	0.099	0.099	1.778E-7	1399	0.084	0.084	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WRT4	0.0	1310	4602	0.478	0.145	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
2	A0A1L1SQU7	0.0	1298	4645	0.478	0.144	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
3	A0A2R8QAL3	0.0	1152	4601	0.451	0.137	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
4	A2BGT8	0.0	1316	4611	0.474	0.144	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
5	F1QA09	0.0	1166	4546	0.451	0.139	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
6	F2Z4A3	0.0	1310	4590	0.478	0.146	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
7	O88277	0.0	2362	4351	0.811	0.261	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
8	Q14517	0.0	1326	4588	0.476	0.145	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
9	Q8BNA6	0.0	1226	4555	0.456	0.140	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
10	Q9NYQ8	0.0	2890	4349	1.000	0.322	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
11	Q9QXA3	0.0	1310	4587	0.478	0.146	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
12	Q9VW71	0.0	764	4699	0.359	0.107	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
13	Q9WU10	0.0	1293	4589	0.476	0.145	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
14	X1WCY4	0.0	1166	4578	0.451	0.138	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
15	Q6V0I7	9.34e-131	451	4981	0.284	0.080	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
16	Q6QQE1	4.82e-116	406	3366	0.273	0.113	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
17	Q2PZL6	2.18e-115	404	4981	0.272	0.076	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
18	Q99PF4	1.51e-112	395	3354	0.276	0.115	CAD23_MOUSE Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2
19	P58365	1.32e-111	393	3317	0.273	0.115	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
20	Q9H251	1.29e-109	387	3354	0.276	0.115	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	4.3e-165	548.1	Cadherin domain
2	PF08266 Cadherin_2	3.8e-09	47.6	Cadherin-like
3	PF16184 Cadherin_3	2.1e-05	35.8	Cadherin-like
4	PF17803 Cadherin_4	6.7	18.7	Bacterial cadherin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261800

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274545	0.801	Gamma-aminobutyric acid receptor subunit alpha-6
2	9606.ENSP00000243389	0.782	Proton-coupled amino acid transporter 1
3	9606.ENSP00000400223	0.715	Four-jointed box protein 1
4	9606.ENSP00000313699	0.693	Hephaestin-like protein 1
5	9606.ENSP00000339115	0.692	Espin-like protein
6	9606.ENSP00000440896	0.687	Inactive phospholipase D5
7	9606.ENSP00000264428	0.681	Glycine receptor subunit beta
8	9606.ENSP00000310585	0.673	Purkinje cell protein 2 homolog
9	9606.ENSP00000309163	0.667	CAAX prenyl protease 2
10	9606.ENSP00000307694	0.664	Potassium voltage-gated channel subfamily S member 1
11	9606.ENSP00000428417	0.663	Regulating synaptic membrane exocytosis protein 1
12	9606.ENSP00000308515	0.657	dephospho-CoA kinase domain containing
13	9606.ENSP00000267406	0.638	Cerebellin-3
14	9606.ENSP00000295108	0.630	Neurogenic differentiation factor 1
15	9606.ENSP00000333255	0.610	Vacuolar ATPase assembly integral membrane protein VMA21
16	9606.ENSP00000258341	0.608	Laminin subunit gamma-1
17	9606.ENSP00000199448	0.602	Mammalian ependymin-related protein 1
18	9606.ENSP00000412130	0.596	Protein MRVI1
19	9606.ENSP00000337512	0.538	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
20	9606.ENSP00000354483	0.533	Inactive dual specificity phosphatase 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.913	cellular process
GO:0032501	0.813	multicellular organismal process
GO:0007155	0.796	cell adhesion
GO:0048856	0.737	anatomical structure development
GO:0090130	0.723	tissue migration
GO:0048870	0.536	cell motility
GO:0098609	0.399	cell-cell adhesion
GO:0016477	0.357	cell migration
GO:0010631	0.306	epithelial cell migration
GO:0007275	0.302	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.991	membrane
GO:0071944	0.946	cell periphery
GO:0005886	0.937	plasma membrane
GO:0043226	0.922	organelle
GO:0030054	0.888	cell junction
GO:0043227	0.814	membrane-bounded organelle
GO:0120025	0.663	plasma membrane bounded cell projection
GO:0005622	0.548	intracellular anatomical structure
GO:0098590	0.396	plasma membrane region
GO:0005576	0.393	extracellular region
GO:0043231	0.350	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]