StarFunc result for job id Q9NYR9

User Input

>input (191 residues)
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFY
DTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGN
KCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLS
RKNKGSGSLDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CR56	0.987	0.987	8.703E-41	191	0.990	0.990	Q9CR56.pdb.gz	KBRS2_MOUSE NF-kappa-B inhibitor-interacting Ras-like protein 2 OS=Mus musculus OX=10090 GN=Nkiras2 PE=1 SV=1
2	AFDB:G5E9P3	0.884	0.879	2.568E-32	192	0.707	0.703	G5E9P3.pdb.gz	G5E9P3_HUMAN NFKB inhibitor interacting Ras like 1 OS=Homo sapiens OX=9606 GN=NKIRAS1 PE=1 SV=1
3	AFDB:Q9V4L4	0.833	0.794	1.793E-19	201	0.393	0.373	Q9V4L4.pdb.gz	KBRAS_DROME NF-kappa-B inhibitor-interacting Ras-like protein OS=Drosophila melanogaster OX=7227 GN=kappaB-Ras PE=1 SV=1
4	AFDB:Q5ANA9	0.823	0.852	5.374E-18	184	0.262	0.272	Q5ANA9.pdb.gz	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
5	AFDB:Q15382	0.814	0.843	1.599E-17	184	0.220	0.228	Q15382.pdb.gz	RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1
6	AFDB:P18613	0.800	0.821	1.939E-17	186	0.257	0.263	P18613.pdb.gz	RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum OX=44689 GN=rapA PE=1 SV=1
7	AFDB:D3Z8L7	0.804	0.712	2.067E-17	218	0.288	0.252	D3Z8L7.pdb.gz	RRAS_RAT Ras-related protein R-Ras OS=Rattus norvegicus OX=10116 GN=Rras PE=1 SV=1
8	AFDB:P01112	0.778	0.786	3.038E-17	189	0.262	0.265	P01112.pdb.gz	RASH_HUMAN GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1
9	AFDB:Q18246	0.813	0.826	3.038E-17	188	0.277	0.282	Q18246.pdb.gz	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
10	AFDB:P32252	0.801	0.778	6.152E-17	197	0.277	0.269	P32252.pdb.gz	RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum OX=44689 GN=rasB PE=1 SV=1
11	PDB:3oesA	0.762	0.920	7.381E-16	157	0.241	0.293	3oesA.pdb.gz	Crystal structure of the small GTPase RhebL1
12	PDB:6zizA	0.781	0.873	1.495E-15	170	0.241	0.271	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
13	PDB:3t5gA	0.776	0.862	9.607E-15	171	0.230	0.257	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
14	PDB:6kykC	0.793	0.891	1.092E-14	169	0.236	0.266	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
15	PDB:2f9mA	0.771	0.807	1.165E-14	182	0.215	0.225	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
16	PDB:1kaoA	0.799	0.908	1.242E-14	167	0.241	0.275	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
17	PDB:1ukvY	0.778	0.756	1.825E-14	197	0.241	0.234	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
18	PDB:6zqtA	0.780	0.857	2.212E-14	173	0.246	0.272	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
19	PDB:1vg8A	0.766	0.793	4.480E-14	184	0.209	0.217	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
20	PDB:1zbdA	0.733	0.787	7.019E-14	177	0.215	0.232	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CR56	2.23e-140	390	191	0.990	0.990	KBRS2_MOUSE NF-kappa-B inhibitor-interacting Ras-like protein 2 OS=Mus musculus OX=10090 GN=Nkiras2 PE=1 SV=1
2	Q8CEC5	1.25e-98	285	192	0.712	0.708	KBRS1_MOUSE NF-kappa-B inhibitor-interacting Ras-like protein 1 OS=Mus musculus OX=10090 GN=Nkiras1 PE=1 SV=1
3	G5E9P3	1.66e-98	285	192	0.707	0.703	G5E9P3_HUMAN NFKB inhibitor interacting Ras like 1 OS=Homo sapiens OX=9606 GN=NKIRAS1 PE=1 SV=1
4	Q9NYS0	2.23e-98	284	192	0.707	0.703	KBRS1_HUMAN NF-kappa-B inhibitor-interacting Ras-like protein 1 OS=Homo sapiens OX=9606 GN=NKIRAS1 PE=1 SV=1
5	Q9V4L4	2.65e-39	135	201	0.398	0.378	KBRAS_DROME NF-kappa-B inhibitor-interacting Ras-like protein OS=Drosophila melanogaster OX=7227 GN=kappaB-Ras PE=1 SV=1
6	Q7PLE9	5.46e-16	75.1	222	0.288	0.248	Q7PLE9_DROME Ras-related protein Rab-21 OS=Drosophila melanogaster OX=7227 GN=Rab21 PE=3 SV=3
7	Q6FLX7	1.74e-15	73.2	206	0.267	0.248	Q6FLX7_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K12672g PE=4 SV=1
8	P01123	3.95e-15	72.4	206	0.262	0.243	YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT1 PE=1 SV=2
9	Q18246	6.49e-15	71.6	188	0.272	0.277	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
10	P32253	7.19e-15	71.2	189	0.277	0.280	RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum OX=44689 GN=rasC PE=1 SV=1
11	Q55BW0	3.10e-14	71.2	278	0.251	0.173	RAPC_DICDI Ras-related protein rapC OS=Dictyostelium discoideum OX=44689 GN=rapC PE=3 SV=1
12	P48555	3.72e-14	69.7	201	0.246	0.234	RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2
13	P36860	3.85e-13	67.0	206	0.272	0.252	RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus OX=10116 GN=Ralb PE=2 SV=1
14	Q5ANA9	4.53e-13	66.6	184	0.267	0.277	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
15	O76173	4.85e-13	66.6	201	0.241	0.229	RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum OX=44689 GN=Rab1C PE=2 SV=1
16	P32254	5.32e-13	66.6	194	0.262	0.258	RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum OX=44689 GN=rasS PE=2 SV=1
17	Q55CB7	6.21e-13	66.6	216	0.257	0.227	RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum OX=44689 GN=rasY PE=3 SV=1
18	Q6IQE6	9.12e-13	66.2	206	0.257	0.238	Q6IQE6_DANRE V-ral simian leukemia viral oncogene homolog Bb (Ras related) OS=Danio rerio OX=7955 GN=zgc:86798 PE=1 SV=1
19	Q6IQP4	1.15e-12	65.5	185	0.220	0.227	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
20	Q6AXT5	1.16e-12	66.2	223	0.272	0.233	RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus OX=10116 GN=Rab21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.5e+02	13.0	AAA ATPase domain
2	PF00025 Arf	0.00046	31.2	ADP-ribosylation factor family
3	PF09894 DUF2121	12	16.9	Uncharacterized protein conserved in archaea (DUF2121)
4	PF10838 DUF2677	3.4e+02	12.6	Protein of unknown function (DUF2677)
5	PF00350 Dynamin_N	0.36	22.4	Dynamin family
6	PF00503 G-alpha	1.8e+02	12.7	G-protein alpha subunit
7	PF00009 GTP_EFTU	0.069	24.2	Elongation factor Tu GTP binding domain
8	PF01926 MMR_HSR1	0.037	25.5	50S ribosome-binding GTPase
9	PF00071 Ras	2.3e-22	90.8	Ras family
10	PF08477 Roc	1.1e-07	43.4	Ras of Complex, Roc, domain of DAPkinase
11	PF03193 RsgA_GTPase	6.2	18.2	RsgA GTPase
12	PF03657 UPF0113	2.8e+02	13.2	UPF0113 PUA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008569299.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572109.1	0.848	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
2	482537.XP_008563759.1	0.732	NF-kappa-B inhibitor beta-like
3	482537.XP_008563891.1	0.732	NF-kappa-B inhibitor beta-like
4	482537.XP_008572149.1	0.732	NF-kappa-B inhibitor beta
5	482537.XP_008569092.1	0.688	Nuclear apoptosis-inducing factor 1
6	482537.XP_008576943.1	0.682	Transcription factor p65
7	482537.XP_008567925.1	0.681	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 14 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
8	482537.XP_008579050.1	0.631	Nuclear factor NF-kappa-B p105 subunit
9	482537.XP_008572187.1	0.604	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008573612.1	0.602	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 5 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
11	482537.XP_008579377.1	0.601	Ral GTPase-activating protein subunit alpha-2
12	482537.XP_008570375.1	0.551	Ras-related and estrogen-regulated growth inhibitor-like protein
13	482537.XP_008563585.1	0.543	Protein ripply2
14	482537.XP_008574660.1	0.543	Kinase suppressor of Ras 2
15	482537.XP_008581540.1	0.543	Kinase suppressor of Ras 2
16	482537.XP_008588796.1	0.543	Kinase suppressor of Ras 2-like
17	482537.XP_008568971.1	0.513	Zinc finger protein 142
18	482537.XP_008582363.1	0.508	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 23 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0032794	0.988	GTPase activating protein binding
GO:1901363	0.901	heterocyclic compound binding
GO:0097159	0.901	organic cyclic compound binding
GO:0032561	0.812	guanyl ribonucleotide binding
GO:0043168	0.788	anion binding
GO:0003924	0.602	GTPase activity
GO:0005525	0.432	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0001959	0.975	regulation of cytokine-mediated signaling pathway
GO:0050896	0.947	response to stimulus
GO:0051716	0.889	cellular response to stimulus
GO:0007154	0.861	cell communication
GO:0010803	0.860	regulation of tumor necrosis factor-mediated signaling pathway
GO:0023052	0.859	signaling
GO:0007165	0.840	signal transduction
GO:0060541	0.832	respiratory system development
GO:0007264	0.752	small GTPase mediated signal transduction
GO:0048286	0.682	lung alveolus development
GO:0140962	0.634	multicellular organismal-level chemical homeostasis
GO:0007265	0.590	Ras protein signal transduction
GO:0048519	0.460	negative regulation of biological process
GO:0048523	0.428	negative regulation of cellular process
GO:0048518	0.413	positive regulation of biological process
GO:0019222	0.376	regulation of metabolic process
GO:0048522	0.336	positive regulation of cellular process
GO:0060255	0.326	regulation of macromolecule metabolic process
GO:0031323	0.302	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0012505	0.981	endomembrane system
GO:0070013	0.898	intracellular organelle lumen
GO:0005783	0.780	endoplasmic reticulum
GO:0031981	0.608	nuclear lumen
GO:0005654	0.397	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.602	GTP + H2O = GDP + H(+) + phosphate

[back to server]