StarFunc result for job id Q9NYT0

User Input

>input (353 residues)
MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITC
PCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNS
FKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEA
VTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLS
TVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL
VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9WV52	0.620	0.620	1.481E-61	353	0.952	0.952	Q9WV52.pdb.gz	PLEK2_MOUSE Pleckstrin-2 OS=Mus musculus OX=10090 GN=Plek2 PE=1 SV=1
2	AFDB:P08567	0.636	0.641	9.327E-35	350	0.374	0.377	P08567.pdb.gz	PLEK_HUMAN Pleckstrin OS=Homo sapiens OX=9606 GN=PLEK PE=1 SV=3
3	AFDB:Q9HB19	0.373	0.328	1.605E-13	425	0.173	0.144	Q9HB19.pdb.gz	PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens OX=9606 GN=PLEKHA2 PE=1 SV=2
4	AFDB:P98174	0.269	0.119	1.890E-13	961	0.156	0.057	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
5	AFDB:Q5RGS4	0.293	0.272	3.087E-13	383	0.176	0.162	Q5RGS4.pdb.gz	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
6	AFDB:Q9HB21	0.283	0.250	3.260E-13	404	0.184	0.161	Q9HB21.pdb.gz	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
7	AFDB:Q9ERS5	0.258	0.216	4.282E-13	425	0.167	0.139	Q9ERS5.pdb.gz	PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus OX=10090 GN=Plekha2 PE=1 SV=1
8	AFDB:Q96M96	0.276	0.150	4.775E-13	766	0.161	0.074	Q96M96.pdb.gz	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
9	AFDB:O88387	0.270	0.144	8.697E-13	766	0.159	0.073	O88387.pdb.gz	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
10	AFDB:Q8BM47	0.259	0.123	1.866E-12	761	0.176	0.081	Q8BM47.pdb.gz	PKHM3_MOUSE Pleckstrin homology domain-containing family M member 3 OS=Mus musculus OX=10090 GN=Plekhm3 PE=1 SV=1
11	PDB:7rx9A	0.245	0.203	1.346E-9	432	0.130	0.106	7rx9A.pdb.gz
12	PDB:3ljuX	0.275	0.261	2.082E-9	373	0.139	0.131	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6bbpA	0.249	0.174	2.358E-6	520	0.142	0.096	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:6u3eA	0.250	0.223	3.647E-6	397	0.093	0.083	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:7c3mA	0.237	0.155	3.647E-6	577	0.108	0.066	7c3mA.pdb.gz
16	PDB:4mk0A	0.253	0.145	4.992E-5	631	0.074	0.041	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:6hhgA	0.241	0.222	5.879E-5	386	0.074	0.067	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:4mt6A	0.273	0.250	7.721E-5	389	0.074	0.067	4mt6A.pdb.gz
19	PDB:6s9wA	0.252	0.218	1.332E-4	411	0.074	0.063	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:4iapA	0.194	0.264	2.705E-4	256	0.091	0.125	4iapA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9WV52	0.0	709	353	0.952	0.952	PLEK2_MOUSE Pleckstrin-2 OS=Mus musculus OX=10090 GN=Plek2 PE=1 SV=1
2	P08567	4.01e-82	255	350	0.377	0.380	PLEK_HUMAN Pleckstrin OS=Homo sapiens OX=9606 GN=PLEK PE=1 SV=3
3	Q9JHK5	2.63e-80	251	350	0.377	0.380	PLEK_MOUSE Pleckstrin OS=Mus musculus OX=10090 GN=Plek PE=1 SV=1
4	C4MBQ2	4.99e-11	65.9	470	0.105	0.079	C4MBQ2_ENTH1 Protein kinase, putative OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=EHI_043140 PE=4 SV=1
5	Q7SYB5	3.11e-10	63.9	612	0.130	0.075	DEFI6_DANRE Differentially expressed in FDCP 6 homolog OS=Danio rerio OX=7955 GN=def6 PE=2 SV=1
6	Q55GV3	4.24e-09	60.1	477	0.105	0.078	PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum OX=44689 GN=pakC PE=1 SV=2
7	Q8C2K1	5.41e-09	60.1	630	0.105	0.059	DEFI6_MOUSE Differentially expressed in FDCP 6 OS=Mus musculus OX=10090 GN=Def6 PE=1 SV=1
8	Q1LYE0	3.37e-08	57.4	588	0.122	0.073	Q1LYE0_DANRE Switch-associated protein 70 OS=Danio rerio OX=7955 GN=fc45f07 PE=1 SV=1
9	Q5RGS4	4.06e-08	56.6	383	0.125	0.115	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
10	Q9ST43	4.29e-08	53.9	145	0.076	0.186	PH1_ARATH Pleckstrin homology domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PH1 PE=2 SV=2
11	Q8BUL6	5.92e-08	56.2	383	0.116	0.107	PKHA1_MOUSE Pleckstrin homology domain-containing family A member 1 OS=Mus musculus OX=10090 GN=Plekha1 PE=1 SV=1
12	Q6A028	6.25e-08	56.6	585	0.096	0.058	SWP70_MOUSE Switch-associated protein 70 OS=Mus musculus OX=10090 GN=Swap70 PE=1 SV=2
13	E7EMB1	8.15e-08	56.2	527	0.093	0.063	E7EMB1_HUMAN Switching B cell complex subunit SWAP70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1
14	Q9H4E7	8.45e-08	56.2	631	0.102	0.057	DEFI6_HUMAN Differentially expressed in FDCP 6 homolog OS=Homo sapiens OX=9606 GN=DEF6 PE=1 SV=1
15	Q9HB21	9.66e-08	55.5	404	0.108	0.094	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
16	Q54KV6	1.11e-07	55.8	570	0.099	0.061	GPA3_DICDI Guanine nucleotide-binding protein alpha-3 subunit OS=Dictyostelium discoideum OX=44689 GN=gpaC PE=3 SV=1
17	Q9UH65	1.16e-07	55.8	585	0.096	0.058	SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1
18	Q7Z5H3	1.26e-06	52.8	698	0.108	0.054	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
19	Q54KA7	2.98e-06	51.6	986	0.102	0.037	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
20	P42331	4.17e-06	50.8	645	0.071	0.039	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	1.3e-12	58.9	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF00169 PH	1.7e-31	120.2	PH domain
3	PF15413 PH_11	1.7e-07	43.0	Pleckstrin homology domain
4	PF16652 PH_13	3.4e+02	12.6	Pleckstrin homology domain
5	PF17838 PH_16	1.9e+02	13.3	PH domain
6	PF08458 PH_2	2e+02	13.7	Plant pleckstrin homology-like region
7	PF20399 PH_20	0.00097	30.5	PH domain
8	PF15404 PH_4	1.4e+02	13.7	Pleckstrin homology domain
9	PF15406 PH_6	15	17.3	Pleckstrin homology domain
10	PF15409 PH_8	12	17.6	Pleckstrin homology domain
11	PF15410 PH_9	0.0016	30.0	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377771	0.688	Signal-induced proliferation-associated protein 1
2	9606.ENSP00000251119	0.674	Zinc finger FYVE domain-containing protein 26
3	9606.ENSP00000261647	0.635	Tetratricopeptide repeat protein 19, mitochondrial
4	9606.ENSP00000355587	0.612	Cancer-related nucleoside-triphosphatase
5	9606.ENSP00000450731	0.610	Vesicle transport through interaction with t-SNAREs homolog 1B
6	9606.ENSP00000248706	0.544	Ras-like protein family member 11B
7	9606.ENSP00000259711	0.544	Kinesin-like protein KIF13A
8	9606.ENSP00000265881	0.518	Oligoribonuclease, mitochondrial
9	9606.ENSP00000375829	0.504	Ladinin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043325	0.998	phosphatidylinositol-3,4-bisphosphate binding
GO:0032266	0.998	phosphatidylinositol-3-phosphate binding
GO:0080025	0.995	phosphatidylinositol-3,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.992	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0016043	0.928	cellular component organization
GO:0006996	0.850	organelle organization
GO:0048518	0.766	positive regulation of biological process
GO:0044089	0.755	positive regulation of cellular component biogenesis
GO:0030029	0.746	actin filament-based process
GO:0031532	0.713	actin cytoskeleton reorganization
GO:0060491	0.606	regulation of cell projection assembly
GO:0120035	0.583	regulation of plasma membrane bounded cell projection organization
GO:0120032	0.567	regulation of plasma membrane bounded cell projection assembly
GO:0051130	0.548	positive regulation of cellular component organization
GO:0050896	0.539	response to stimulus
GO:0051716	0.502	cellular response to stimulus
GO:0031346	0.313	positive regulation of cell projection organization
GO:0120034	0.302	positive regulation of plasma membrane bounded cell projection assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.997	cell periphery
GO:0005886	0.993	plasma membrane
GO:0005622	0.915	intracellular anatomical structure
GO:0005737	0.900	cytoplasm
GO:0043231	0.594	intracellular membrane-bounded organelle
GO:0005829	0.339	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]