StarFunc result for job id Q9NYU1

User Input

>input (1516 residues)
MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEES
NEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQ
MFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKEN
LPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKS
TEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKEIYSDLRDNLTAFQKYLIESNKQ
MMPLKVWELQDLSFQAASQIMSAPVYDSIKLMKDISQNFPIKARSLTRIAVNQHMREEIK
ENQKDLQVRFKIQPGDARLFINGLRVDMDVYDAFSILDMLKLEGKMMNGLRNLGINGEDM
SKFLKLNSHIWEYTYVLDIRHSSIMWINDLENDDLYITWPTSCQKLLKPVFPGSVPSIRR
NFHNLVLFIDPAQEYTLDFIKLADVFYSHEVPLRIGFVFILNTDDEVDGANDAGVALWRA
FNYIAEEFDISEAFISIVHMYQKVKKDQNILTVDNVKSVLQNTFPHANIWDILGIHSKYD
EERKAGASFYKMTGLGPLPQALYNGEPFKHEEMNIKELKMAVLQRMMDASVYLQREVFLG
TLNDRTNAIDFLMDRNNVVPRINTLILRTNQQYLNLISTSVTADVEDFSTFFFLDSQDKS
AVIAKNMYYLTQDDESIISAVTLWIIADFDKPSGRKLLFNALKHMKTSVHSRLGIIYNPT
SKINEENTAISRGILAAFLTQKNMFLRSFLGQLAKEEIATAIYSGDKIKTFLIEGMDKNA
FEKKYNTVGVNIFRTHQLFCQDVLKLRPGEMGIVSNGRFLGPLDEDFYAEDFYLLEKITF
SNLGEKIKGIVENMGINANNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQE
NDMFFNVIAIVDPLTREAQKMAQLLVVLGKIINMKIKLFMNCRGRLSEAPLESFYRFVLE
PELMSGANDVSSLGPVAKFLDIPESPLLILNMITPEGWLVETVHSNCDLDNIHLKDTEKT
VTAEYELEYLLLEGQCFDKVTEQPPRGLQFTLGTKNKPAVVDTIVMAHHGYFQLKANPGA
WILRLHQGKSEDIYQIVGHEGTDSQADLEDIIVVLNSFKSKILKVKVKKETDKIKEDILT
DEDEKTKGLWDSIKSFTVSLHKENKKEKDVLNIFSVASGHLYERFLRIMMLSVLRNTKTP
VKFWLLKNYLSPTFKEVIPHMAKEYGFRYELVQYRWPRWLRQQTERQRIIWGYKILFLDV
LFPLAVDKIIFVDADQIVRHDLKELRDFDLDGAPYGYTPFCDSRREMDGYRFWKTGYWAS
HLLRRKYHISALYVVDLKKFRRIGAGDRLRSQYQALSQDPNSLSNLDQDLPNNMIYQVAI
KSLPQDWLWCETWCDDESKQRAKTIDLCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLD
HLENKKQDTILTHDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EF14	0.716	0.779	0.000	1381	0.332	0.365	G5EF14.pdb.gz	G5EF14_CAEEL UDP-glucose:Glycoprotein Glucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-2 PE=3 SV=1
2	AFDB:Q09140	0.699	0.728	0.000	1448	0.290	0.303	Q09140.pdb.gz	UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
3	AFDB:Q09332	0.901	0.883	0.000	1548	0.402	0.393	Q09332.pdb.gz	UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
4	AFDB:Q0WL80	0.806	0.762	0.000	1613	0.348	0.327	Q0WL80.pdb.gz	UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
5	AFDB:Q8T191	0.634	0.576	0.000	1681	0.334	0.301	Q8T191.pdb.gz	UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
6	AFDB:Q9GPA0	0.866	0.879	0.000	1493	0.402	0.409	Q9GPA0.pdb.gz	Q9GPA0_CAEEL UDP-Glucose Glycoprotein glucosylTransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-1 PE=1 SV=1
7	AFDB:Q9NYU1	1.000	1.000	0.000	1516	1.000	1.000	Q9NYU1.pdb.gz	UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
8	AFDB:Q9NYU2	0.956	0.932	0.000	1555	0.548	0.534	Q9NYU2.pdb.gz	UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
9	AFDB:Q582S2	0.684	0.627	9.783E-102	1675	0.276	0.250	Q582S2.pdb.gz	Q582S2_TRYB2 UDP-glucose:glycoprotein glucosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.100 PE=3 SV=1
10	AFDB:A0A1D8PJN6	0.556	0.581	1.828E-85	1447	0.245	0.257	A0A1D8PJN6.pdb.gz	A0A1D8PJN6_CANAL Kre5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KRE5 PE=3 SV=1
11	PDB:8cvzI	0.129	0.599	4.456E-5	267	0.024	0.135	8cvzI.pdb.gz
12	PDB:4y63A	0.116	0.527	5.383E-5	282	0.027	0.145	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:1ll0B	0.128	0.603	1.202E-4	267	0.024	0.135	1ll0B.pdb.gz
14	PDB:7d72A	0.105	0.334	3.282E-3	407	0.017	0.064	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
15	PDB:3f4tA	0.094	0.552	3.607E-3	200	0.015	0.110	3f4tA.pdb.gz
16	PDB:6fxrA	0.092	0.176	3.607E-3	700	0.024	0.053	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
17	PDB:5l6sN	0.084	0.279	6.989E-3	369	0.019	0.079	5l6sN.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
18	PDB:1jzdA	0.079	0.401	1.420E-2	219	0.016	0.110	1jzdA.pdb.gz
19	PDB:7x8kB	0.089	0.289	1.420E-2	367	0.018	0.074	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
20	PDB:5a07A	0.090	0.282	2.624E-2	395	0.016	0.061	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EF14	0.0	780	1381	0.349	0.383	G5EF14_CAEEL UDP-glucose:Glycoprotein Glucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-2 PE=3 SV=1
2	Q09140	0.0	611	1448	0.307	0.322	UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
3	Q09332	0.0	1111	1548	0.409	0.401	UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
4	Q0WL80	0.0	814	1613	0.354	0.332	UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
5	Q6P5E4	0.0	1708	1551	0.551	0.539	UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
6	Q8T191	0.0	682	1681	0.354	0.319	UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
7	Q9GPA0	0.0	1147	1493	0.416	0.422	Q9GPA0_CAEEL UDP-Glucose Glycoprotein glucosylTransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-1 PE=1 SV=1
8	Q9JLA3	0.0	1700	1551	0.544	0.531	UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
9	Q9NYU1	0.0	3147	1516	1.000	1.000	UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
10	Q9NYU2	0.0	1696	1555	0.547	0.533	UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
11	Q582S2	1.51e-135	461	1675	0.289	0.261	Q582S2_TRYB2 UDP-glucose:glycoprotein glucosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.100 PE=3 SV=1
12	A0A1D8PJN6	3.07e-120	414	1447	0.151	0.158	A0A1D8PJN6_CANAL Kre5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KRE5 PE=3 SV=1
13	P22023	8.98e-20	99.0	1365	0.048	0.053	KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE5 PE=1 SV=2
14	Q9M8J2	0.002	44.3	351	0.028	0.120	GATL4_ARATH Probable galacturonosyltransferase-like 4 OS=Arabidopsis thaliana OX=3702 GN=GATL4 PE=2 SV=1
15	Q8VYF4	0.14	38.9	361	0.026	0.108	GATL7_ARATH Probable galacturonosyltransferase-like 7 OS=Arabidopsis thaliana OX=3702 GN=GATL7 PE=2 SV=1
16	Q0WV13	0.40	37.7	533	0.012	0.034	GAUTD_ARATH Probable galacturonosyltransferase 13 OS=Arabidopsis thaliana OX=3702 GN=GAUT13 PE=1 SV=1
17	Q0V7R1	0.66	36.6	345	0.026	0.116	GATL3_ARATH Probable galacturonosyltransferase-like 3 OS=Arabidopsis thaliana OX=3702 GN=GATL3 PE=2 SV=1
18	Q8GWT1	1.1	36.2	532	0.013	0.036	GAUTE_ARATH Probable galacturonosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=GAUT14 PE=1 SV=1
19	O04536	1.6	35.4	390	0.030	0.115	GATL9_ARATH Probable galacturonosyltransferase-like 9 OS=Arabidopsis thaliana OX=3702 GN=GATL9 PE=2 SV=1
20	Q9LE59	2.3	35.0	673	0.020	0.045	GAUT1_ARATH Polygalacturonate 4-alpha-galacturonosyltransferase OS=Arabidopsis thaliana OX=3702 GN=GAUT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18404 Glyco_transf_24	4.4e-141	480.5	Glucosyltransferase 24
2	PF01501 Glyco_transf_8	0.0056	27.8	Glycosyl transferase family 8
3	PF18400 Thioredoxin_12	1e-51	187.1	Thioredoxin-like domain
4	PF18401 Thioredoxin_13	1.4e-34	130.4	Thioredoxin-like domain
5	PF18402 Thioredoxin_14	2.1e-54	196.7	Thioredoxin-like domain
6	PF18403 Thioredoxin_15	8.2e-59	210.7	Thioredoxin-like domain
7	PF06427 UDP-g_GGTase	1.3e-31	120.3	UDP-glucose:Glycoprotein Glucosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259253	0.825	UDP-glucose:glycoprotein glucosyltransferase 1
2	9606.ENSP00000233616	0.798	Mannosyl-oligosaccharide glucosidase
3	9606.ENSP00000318165	0.783	Protein OS-9
4	9606.ENSP00000270586	0.768	Proteasome subunit beta type-6
5	9606.ENSP00000363616	0.753	ER degradation-enhancing alpha-mannosidase-like protein 2
6	9606.ENSP00000362334	0.744	Proteasome subunit beta type-2
7	9606.ENSP00000185150	0.735	Endoplasmic reticulum lectin 1
8	9606.ENSP00000262193	0.730	Proteasome subunit beta type-1
9	9606.ENSP00000483688	0.730	Proteasome subunit beta type-3
10	9606.ENSP00000247461	0.716	Calnexin
11	9606.ENSP00000340466	0.699	Neutral alpha-glucosidase AB
12	9606.ENSP00000230048	0.695	Acyl-coenzyme A thioesterase 13
13	9606.ENSP00000416002	0.683	UDP-galactose translocator
14	9606.ENSP00000267085	0.680	Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L- alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3- sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate
15	9606.ENSP00000389277	0.666	Bax inhibitor 1
16	9606.ENSP00000360149	0.665	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
17	9606.ENSP00000367440	0.665	Tyrosyl-DNA phosphodiesterase 2
18	9606.ENSP00000356355	0.650	Serine/threonine-protein kinase Nek7
19	9606.ENSP00000259457	0.648	Proteasome subunit beta type-7
20	9606.ENSP00000351314	0.648	Proteasome subunit beta type-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003980	1.000	UDP-glucose:glycoprotein glucosyltransferase activity
GO:0051082	0.306	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0009100	0.992	glycoprotein metabolic process
GO:0006517	0.954	protein deglycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005788	0.996	endoplasmic reticulum lumen
GO:0032991	0.989	protein-containing complex
GO:0016020	0.526	membrane
GO:0070062	0.526	extracellular exosome
GO:0031981	0.423	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]