StarFunc result for job id Q9NYU2

User Input

>input (1555 residues)
MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPL
LLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKF
CLSLRSYSATIQAFQQIAADEPPPEGCNSFFSVHGKKTCESDTLEALLLTASERPKPLLF
KGDHRYPSSNPESPVVIFYSEIGSEEFSNFHRQLISKSNAGKINYVFRHYIFNPRKEPVY
LSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFLFGKLRDLHPDLEGQ
LKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLSQNFPTKARAI
TKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARV
MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQEL
LRPTFPGVIRQIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLRIGFIFVVNDSED
VDGMQDAGVAVLRAYNYVAQEVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYV
EVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKIL
ETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDY
ARFTILDSQGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYD
AIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAE
ALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRII
GPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKG
DPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRV
FMNCQSKLSDMPLKSFYRYVLEPEISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPESW
MVESVRTPYDLDNIYLEEVDSVVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANP
VIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDADEVVIVLNNF
KSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFS
VASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYK
WPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPY
GYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQG
LSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKE
PKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EF14	0.691	0.768	0.000	1381	0.330	0.371	G5EF14.pdb.gz	G5EF14_CAEEL UDP-glucose:Glycoprotein Glucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-2 PE=3 SV=1
2	AFDB:Q09140	0.678	0.722	0.000	1448	0.272	0.292	Q09140.pdb.gz	UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
3	AFDB:Q09332	0.889	0.893	0.000	1548	0.426	0.428	Q09332.pdb.gz	UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
4	AFDB:Q0WL80	0.778	0.753	0.000	1613	0.345	0.333	Q0WL80.pdb.gz	UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
5	AFDB:Q8T191	0.611	0.568	0.000	1681	0.326	0.302	Q8T191.pdb.gz	UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
6	AFDB:Q9GPA0	0.852	0.886	0.000	1493	0.405	0.422	Q9GPA0.pdb.gz	Q9GPA0_CAEEL UDP-Glucose Glycoprotein glucosylTransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-1 PE=1 SV=1
7	AFDB:Q9NYU1	0.933	0.956	0.000	1516	0.534	0.548	Q9NYU1.pdb.gz	UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
8	AFDB:Q9NYU2	1.000	1.000	0.000	1555	1.000	1.000	Q9NYU2.pdb.gz	UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
9	AFDB:Q582S2	0.665	0.625	2.204E-99	1675	0.271	0.251	Q582S2.pdb.gz	Q582S2_TRYB2 UDP-glucose:glycoprotein glucosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.100 PE=3 SV=1
10	AFDB:A0A1D8PJN6	0.542	0.579	1.626E-87	1447	0.243	0.261	A0A1D8PJN6.pdb.gz	A0A1D8PJN6_CANAL Kre5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KRE5 PE=3 SV=1
11	PDB:4y63A	0.114	0.519	3.617E-5	282	0.024	0.135	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
12	PDB:8cvzI	0.112	0.513	4.376E-5	267	0.025	0.146	8cvzI.pdb.gz
13	PDB:1ll0B	0.114	0.543	1.031E-4	267	0.025	0.146	1ll0B.pdb.gz
14	PDB:3f4tA	0.090	0.520	1.285E-3	200	0.017	0.135	3f4tA.pdb.gz
15	PDB:7d72A	0.098	0.319	1.710E-3	407	0.020	0.076	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
16	PDB:7x8kB	0.087	0.278	8.229E-3	367	0.017	0.074	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
17	PDB:4zilA	0.079	0.436	1.389E-2	210	0.020	0.148	4zilA.pdb.gz
18	PDB:7sckA	0.084	0.182	2.033E-2	642	0.014	0.033	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
19	PDB:5a07A	0.086	0.282	2.580E-2	395	0.023	0.091	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae
20	PDB:3rpnA	0.073	0.391	3.600E-2	220	0.014	0.095	3rpnA.pdb.gz	Crystal structures and kinetic studies of human Kappa class glutathione transferase provide insights into the catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EF14	0.0	822	1381	0.344	0.387	G5EF14_CAEEL UDP-glucose:Glycoprotein Glucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-2 PE=3 SV=1
2	Q09140	0.0	621	1448	0.298	0.320	UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
3	Q09332	0.0	1248	1548	0.439	0.441	UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
4	Q0WL80	0.0	875	1613	0.362	0.349	UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
5	Q6P5E4	0.0	2890	1551	0.907	0.909	UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
6	Q9GPA0	0.0	1201	1493	0.414	0.431	Q9GPA0_CAEEL UDP-Glucose Glycoprotein glucosylTransferase OS=Caenorhabditis elegans OX=6239 GN=uggt-1 PE=1 SV=1
7	Q9JLA3	0.0	2909	1551	0.915	0.917	UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
8	Q9NYU1	0.0	1729	1516	0.536	0.550	UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
9	Q9NYU2	0.0	3235	1555	1.000	1.000	UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
10	Q8T191	1.06e-180	587	1681	0.220	0.203	UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
11	Q582S2	3.37e-124	429	1675	0.154	0.143	Q582S2_TRYB2 UDP-glucose:glycoprotein glucosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.100 PE=3 SV=1
12	A0A1D8PJN6	2.19e-122	421	1447	0.150	0.162	A0A1D8PJN6_CANAL Kre5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KRE5 PE=3 SV=1
13	P22023	2.97e-21	103	1365	0.068	0.078	KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE5 PE=1 SV=2
14	Q9M8J2	7.45e-04	46.2	351	0.028	0.125	GATL4_ARATH Probable galacturonosyltransferase-like 4 OS=Arabidopsis thaliana OX=3702 GN=GATL4 PE=2 SV=1
15	O04536	1.5	35.4	390	0.017	0.067	GATL9_ARATH Probable galacturonosyltransferase-like 9 OS=Arabidopsis thaliana OX=3702 GN=GATL9 PE=2 SV=1
16	Q08877	5.5	33.9	869	0.017	0.030	DYN3_RAT Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE=1 SV=2
17	Q8BZ98	5.5	33.9	863	0.017	0.030	DYN3_MOUSE Dynamin-3 OS=Mus musculus OX=10090 GN=Dnm3 PE=1 SV=1
18	Q9UQ16	8.1	33.5	869	0.016	0.029	DYN3_HUMAN Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4
19	Q77CC8	8.9	33.5	1246	0.014	0.018	Q77CC8_9ALPH DNA polymerase OS=Bovine herpesvirus type 1.1 OX=79889 GN=UL30 PE=3 SV=1
20	Q0WV13	9.6	33.1	533	0.011	0.032	GAUTD_ARATH Probable galacturonosyltransferase 13 OS=Arabidopsis thaliana OX=3702 GN=GAUT13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18404 Glyco_transf_24	5e-145	493.5	Glucosyltransferase 24
2	PF01501 Glyco_transf_8	13	16.8	Glycosyl transferase family 8
3	PF18400 Thioredoxin_12	1.3e-50	183.5	Thioredoxin-like domain
4	PF18401 Thioredoxin_13	7.7e-33	124.7	Thioredoxin-like domain
5	PF18402 Thioredoxin_14	7.5e-66	234.2	Thioredoxin-like domain
6	PF18403 Thioredoxin_15	7e-63	224.0	Thioredoxin-like domain
7	PF06427 UDP-g_GGTase	8.6e-36	133.7	UDP-glucose:Glycoprotein Glucosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259253

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247461	0.989	Calnexin
2	9606.ENSP00000381666	0.921	Glucoside xylosyltransferase 1
3	9606.ENSP00000320866	0.918	Calreticulin
4	9606.ENSP00000374268	0.912	Glucoside xylosyltransferase 2
5	9606.ENSP00000259241	0.908	Heparan-sulfate 6-O-sulfotransferase 1
6	9606.ENSP00000233616	0.884	Mannosyl-oligosaccharide glucosidase
7	9606.ENSP00000318165	0.862	Protein OS-9
8	9606.ENSP00000185150	0.850	Endoplasmic reticulum lectin 1
9	9606.ENSP00000328729	0.836	May be involved in redox reactions associated with the formation of disulfide bonds (By similarity). May contribute to the quality control of protein folding in the endoplasmic reticulum . May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2 .
10	9606.ENSP00000340466	0.828	Neutral alpha-glucosidase AB
11	9606.ENSP00000365938	0.825	UDP-glucose:glycoprotein glucosyltransferase 2
12	9606.ENSP00000360149	0.818	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
13	9606.ENSP00000270586	0.791	Proteasome subunit beta type-6
14	9606.ENSP00000360645	0.789	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
15	9606.ENSP00000300289	0.772	Protein disulfide-isomerase A3
16	9606.ENSP00000256497	0.767	ER degradation-enhancing alpha-mannosidase-like protein 1
17	9606.ENSP00000266556	0.760	Tapasin-related protein
18	9606.ENSP00000362334	0.744	Proteasome subunit beta type-2
19	9606.ENSP00000262193	0.730	Proteasome subunit beta type-1
20	9606.ENSP00000483688	0.730	Proteasome subunit beta type-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	1.000	unfolded protein binding
GO:0003980	1.000	UDP-glucose:glycoprotein glucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006458	0.996	'de novo' protein folding
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0044237	0.970	cellular metabolic process
GO:0043170	0.959	macromolecule metabolic process
GO:1901564	0.956	organonitrogen compound metabolic process
GO:0019538	0.952	protein metabolic process
GO:0009100	0.935	glycoprotein metabolic process
GO:0051084	0.929	'de novo' post-translational protein folding
GO:0036211	0.905	protein modification process
GO:0006517	0.484	protein deglycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005788	0.999	endoplasmic reticulum lumen
GO:0005576	0.979	extracellular region
GO:0032991	0.960	protein-containing complex
GO:0043230	0.926	extracellular organelle
GO:0070062	0.916	extracellular exosome
GO:0016020	0.712	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]