StarFunc result for job id Q9NYV4

User Input

>input (1490 residues)
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEA
ASLGTVIKPLVEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSR
DLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDYGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGA
SYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYKEPSAYQSSTRSPSPYSRRQR
SVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
AYSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKES
KGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGK
VKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQAN
SQPPVQVSVKTQVSVTAAIPHLKTSTLPPLPLPPLLPGDDDMDSPKETLPSKPVKKEKEQ
RTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQTESDWG
KRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQ
LIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFM
KQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVW
PDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL
KDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNI
HSNPEMQQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEAS
STPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPPHIL
PPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEH
QALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
SHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNY
GELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYV4	0.999	0.999	0.000	1490	1.000	1.000	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
2	AFDB:Q14004	0.297	0.293	6.268E-91	1512	0.435	0.429	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
3	PDB:3mi9A	0.192	0.846	7.055E-32	329	0.097	0.441	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
4	PDB:1unlA	0.186	0.915	2.233E-28	292	0.081	0.411	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
5	PDB:4krcA	0.185	0.897	7.118E-27	297	0.077	0.384	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
6	PDB:4yc3A	0.182	0.875	4.727E-26	295	0.083	0.417	4yc3A.pdb.gz
7	PDB:4eomC	0.177	0.914	1.252E-25	276	0.081	0.435	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
8	PDB:4gcjA	0.184	0.853	1.554E-25	304	0.087	0.428	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
9	PDB:4ek6A	0.174	0.873	5.229E-24	279	0.078	0.416	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
10	PDB:7opmA	0.190	0.749	9.195E-23	362	0.077	0.318	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
11	PDB:2b9iA	0.174	0.727	4.659E-22	338	0.070	0.311	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
12	PDB:1blxA	0.174	0.773	8.447E-22	305	0.077	0.377	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
13	AFDB:Q09690	0.179	0.242	9.757E-19	1087	0.132	0.180	Q09690.pdb.gz	POM1_SCHPO DYRK-family kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pom1 PE=1 SV=1
14	AFDB:Q9VUQ9	0.178	0.128	1.425E-18	2139	0.167	0.116	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
15	AFDB:B3DI12	0.189	0.267	4.684E-18	1039	0.119	0.170	B3DI12.pdb.gz	B3DI12_DANRE Cyclin-dependent kinase-like 5 isoform 2 OS=Danio rerio OX=7955 GN=zgc:194395 PE=2 SV=1
16	AFDB:O76039	0.185	0.284	4.684E-18	960	0.123	0.192	O76039.pdb.gz	CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=2
17	AFDB:F4HQ88	0.180	0.226	1.113E-17	1169	0.126	0.160	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
18	AFDB:P0CY24	0.170	0.204	1.912E-17	1228	0.141	0.171	P0CY24.pdb.gz	STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CST20 PE=3 SV=1
19	AFDB:A0A669KBC2	0.181	0.266	3.283E-17	1001	0.123	0.184	A0A669KBC2.pdb.gz	A0A669KBC2_HUMAN Cyclin dependent kinase like 5 OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=1
20	AFDB:Q58FB8	0.157	0.213	8.693E-17	1068	0.134	0.186	Q58FB8.pdb.gz	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4Z0	0.0	791	1308	0.273	0.311	A0A2R8Y4Z0_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
2	A0A2R8Y7W5	0.0	731	1099	0.236	0.319	A0A2R8Y7W5_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
3	A0A2R8YF61	0.0	723	915	0.236	0.384	A0A2R8YF61_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
4	J3QSD7	0.0	2417	1201	0.806	1.000	J3QSD7_HUMAN Cyclin dependent kinase 12 (Fragment) OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=1
5	Q14004	0.0	803	1512	0.274	0.270	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
6	Q14AX6	0.0	2343	1484	0.902	0.906	CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus OX=10090 GN=Cdk12 PE=1 SV=2
7	Q3MJK5	0.0	2318	1484	0.908	0.912	CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus OX=10116 GN=Cdk12 PE=1 SV=1
8	Q69ZA1	0.0	819	1511	0.334	0.330	CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus OX=10090 GN=Cdk13 PE=1 SV=3
9	Q9NYV4	0.0	3014	1490	1.000	1.000	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
10	A0A2R8YD28	4.00e-179	543	456	0.173	0.566	A0A2R8YD28_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
11	Q9VP22	6.65e-177	562	1157	0.187	0.241	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1
12	P46551	2.01e-133	432	730	0.148	0.301	CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans OX=6239 GN=cdk-12 PE=1 SV=4
13	Q9LFT8	2.14e-112	367	505	0.120	0.354	CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana OX=3702 GN=CDKC-1 PE=1 SV=1
14	Q8W4P1	2.07e-111	364	513	0.119	0.347	CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana OX=3702 GN=CDKC-2 PE=1 SV=2
15	O14098	9.09e-94	318	593	0.107	0.270	CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsk1 PE=1 SV=1
16	Q641Z4	4.82e-91	302	372	0.101	0.403	CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus OX=10116 GN=Cdk9 PE=2 SV=1
17	Q99J95	4.82e-91	302	372	0.101	0.403	CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus OX=10090 GN=Cdk9 PE=1 SV=1
18	Q7SXE8	1.82e-90	300	374	0.100	0.398	CDK9_DANRE Cyclin-dependent kinase 9 OS=Danio rerio OX=7955 GN=cdk9 PE=2 SV=1
19	P50750	1.43e-89	298	372	0.099	0.395	CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3
20	Q9CAG1	5.74e-87	303	752	0.109	0.217	Q9CAG1_ARATH cyclin-dependent kinase OS=Arabidopsis thaliana OX=3702 GN=CDKG2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0074	27.0	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	0.051	24.1	Haspin like kinase domain
3	PF14531 Kinase-like	24	15.7	Kinase-like
4	PF00069 Pkinase	4.4e-70	247.7	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	2.7e-30	117.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374529	0.999	Cyclin-K
2	9606.ENSP00000480158	0.983	DNA-directed RNA polymerase II subunit RPB1
3	9606.ENSP00000470252	0.974	Transcription elongation factor SPT5
4	9606.ENSP00000261900	0.938	Cyclin-T1
5	9606.ENSP00000256897	0.924	Cyclin-H
6	9606.ENSP00000264157	0.913	Cyclin-T2
7	9606.ENSP00000181839	0.900	Cyclin-dependent kinase 13
8	9606.ENSP00000262643	0.874	G1/S-specific cyclin-E1
9	9606.ENSP00000484525	0.869	RNA polymerase II subunit A C-terminal domain phosphatase
10	9606.ENSP00000362361	0.866	Cyclin-dependent kinase 9
11	9606.ENSP00000274026	0.864	Cyclin-A2
12	9606.ENSP00000225504	0.848	Transcription elongation factor SPT4
13	9606.ENSP00000216297	0.825	FACT complex subunit SPT16
14	9606.ENSP00000296328	0.824	UBX domain-containing protein 7
15	9606.ENSP00000256443	0.818	Cyclin-dependent kinase 7
16	9606.ENSP00000258962	0.810	Serine/arginine-rich splicing factor 1
17	9606.ENSP00000256442	0.808	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000429089	0.799	G1/S-specific cyclin-E2
19	9606.ENSP00000255465	0.792	Cyclin-A1
20	9606.ENSP00000363836	0.788	Cyclin-Y

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding
GO:0008353	1.000	RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0019899	0.995	enzyme binding
GO:0019900	0.757	kinase binding
GO:0019901	0.717	protein kinase binding
GO:1901363	0.359	heterocyclic compound binding
GO:0097159	0.358	organic cyclic compound binding
GO:0003676	0.309	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0090304	0.970	nucleic acid metabolic process
GO:0010467	0.939	gene expression
GO:0016070	0.939	RNA metabolic process
GO:0019219	0.891	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.890	regulation of gene expression
GO:0051252	0.879	regulation of RNA metabolic process
GO:0010556	0.633	regulation of macromolecule biosynthetic process
GO:0031326	0.633	regulation of cellular biosynthetic process
GO:0006355	0.615	regulation of DNA-templated transcription
GO:0006351	0.608	DNA-templated transcription
GO:0006366	0.544	transcription by RNA polymerase II
GO:0036211	0.532	protein modification process
GO:0048519	0.441	negative regulation of biological process
GO:0048518	0.428	positive regulation of biological process
GO:0048523	0.392	negative regulation of cellular process
GO:0048522	0.391	positive regulation of cellular process
GO:0006357	0.380	regulation of transcription by RNA polymerase II
GO:0065009	0.366	regulation of molecular function
GO:0051246	0.361	regulation of protein metabolic process
GO:0009893	0.302	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.999	nuclear body
GO:0032991	0.998	protein-containing complex
GO:1902494	0.987	catalytic complex
GO:0016607	0.980	nuclear speck
GO:1990234	0.972	transferase complex
GO:0061695	0.956	transferase complex, transferring phosphorus-containing groups
GO:0140513	0.953	nuclear protein-containing complex
GO:1902911	0.817	protein kinase complex
GO:1902554	0.795	serine/threonine protein kinase complex
GO:0000307	0.759	cyclin-dependent protein kinase holoenzyme complex
GO:0005737	0.557	cytoplasm
GO:0002944	0.386	cyclin K-CDK12 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10216	1.000	[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase]
EC:2.7.11.23	1.000	[RNA-polymerase]-subunit kinase.

[back to server]