StarFunc result for job id Q9NYV7

User Input

>input (291 residues)
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ
WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW
RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQA
HTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF
LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYV7	1.000	1.000	3.764E-37	291	1.000	1.000	Q9NYV7.pdb.gz	T2R16_HUMAN Taste receptor type 2 member 16 OS=Homo sapiens OX=9606 GN=TAS2R16 PE=1 SV=1
2	AFDB:P59529	0.929	0.905	1.547E-21	299	0.529	0.515	P59529.pdb.gz	T2R16_MOUSE Taste receptor type 2 member 16 OS=Mus musculus OX=10090 GN=Tas2r16 PE=2 SV=1
3	AFDB:Q67ES7	0.864	0.771	5.677E-17	329	0.361	0.319	Q67ES7.pdb.gz	TR134_RAT Taste receptor type 2 member 134 OS=Rattus norvegicus OX=10116 GN=Tas2r134 PE=2 SV=1
4	AFDB:P59536	0.876	0.833	1.016E-14	307	0.354	0.336	P59536.pdb.gz	T2R41_HUMAN Taste receptor type 2 member 41 OS=Homo sapiens OX=9606 GN=TAS2R41 PE=1 SV=2
5	AFDB:P59551	0.887	0.816	1.908E-13	318	0.316	0.289	P59551.pdb.gz	T2R60_HUMAN Taste receptor type 2 member 60 OS=Homo sapiens OX=9606 GN=TAS2R60 PE=2 SV=1
6	AFDB:P59532	0.862	0.817	1.996E-13	308	0.323	0.305	P59532.pdb.gz	T2R41_MOUSE Taste receptor type 2 member 41 OS=Mus musculus OX=10090 GN=Tas2r41 PE=2 SV=1
7	AFDB:Q9NYW1	0.833	0.780	1.268E-12	312	0.268	0.250	Q9NYW1.pdb.gz	TA2R9_HUMAN Taste receptor type 2 member 9 OS=Homo sapiens OX=9606 GN=TAS2R9 PE=1 SV=1
8	AFDB:Q2AB83	0.854	0.803	1.739E-12	311	0.258	0.241	Q2AB83.pdb.gz	T2R40_CHICK Taste receptor type 2 member 40 OS=Gallus gallus OX=9031 GN=TAS2R40 PE=1 SV=1
9	AFDB:Q9NYW6	0.835	0.774	3.918E-12	316	0.265	0.244	Q9NYW6.pdb.gz	TA2R3_HUMAN Taste receptor type 2 member 3 OS=Homo sapiens OX=9606 GN=TAS2R3 PE=2 SV=3
10	AFDB:G1NQR8	0.872	0.820	4.909E-12	311	0.271	0.254	G1NQR8.pdb.gz	G1NQR8_MELGA Taste receptor type 2 OS=Meleagris gallopavo OX=9103 GN=LOC104909416 PE=3 SV=2
11	PDB:7xp4R	0.696	0.680	1.977E-9	299	0.254	0.247	7xp4R.pdb.gz
12	PDB:7wv9R	0.694	0.697	1.192E-4	290	0.137	0.138	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
13	PDB:7x9yR	0.613	0.609	1.710E-4	293	0.168	0.167	7x9yR.pdb.gz
14	PDB:7wq3R	0.689	0.693	2.453E-4	289	0.127	0.128	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
15	PDB:6iblA	0.612	0.471	2.808E-4	397	0.127	0.093	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
16	PDB:7x9cR	0.646	0.626	2.938E-4	302	0.120	0.116	7x9cR.pdb.gz
17	PDB:7sqoR	0.669	0.716	3.215E-4	270	0.141	0.152	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
18	PDB:7e32R	0.649	0.661	3.519E-4	285	0.117	0.119	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
19	PDB:7wicR	0.659	0.665	3.681E-4	288	0.131	0.132	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
20	PDB:7e33R	0.651	0.727	3.851E-4	257	0.127	0.144	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NYV7	0.0	584	291	1.000	1.000	T2R16_HUMAN Taste receptor type 2 member 16 OS=Homo sapiens OX=9606 GN=TAS2R16 PE=1 SV=1
2	P59529	8.70e-97	288	299	0.529	0.515	T2R16_MOUSE Taste receptor type 2 member 16 OS=Mus musculus OX=10090 GN=Tas2r16 PE=2 SV=1
3	Q9JKU0	1.38e-87	265	299	0.519	0.505	T2R16_RAT Taste receptor type 2 member 16 OS=Rattus norvegicus OX=10116 GN=Tas2r16 PE=1 SV=1
4	Q67ES7	3.47e-61	199	329	0.381	0.337	TR134_RAT Taste receptor type 2 member 134 OS=Rattus norvegicus OX=10116 GN=Tas2r134 PE=2 SV=1
5	P59532	1.11e-40	145	308	0.320	0.302	T2R41_MOUSE Taste receptor type 2 member 41 OS=Mus musculus OX=10090 GN=Tas2r41 PE=2 SV=1
6	Q9JKE7	2.63e-40	144	308	0.309	0.292	T2R41_RAT Taste receptor type 2 member 41 OS=Rattus norvegicus OX=10116 GN=Tas2r41 PE=1 SV=1
7	P59536	2.35e-39	141	307	0.333	0.316	T2R41_HUMAN Taste receptor type 2 member 41 OS=Homo sapiens OX=9606 GN=TAS2R41 PE=1 SV=2
8	P59551	6.15e-39	140	318	0.306	0.280	T2R60_HUMAN Taste receptor type 2 member 60 OS=Homo sapiens OX=9606 GN=TAS2R60 PE=2 SV=1
9	P59530	4.02e-22	95.9	312	0.282	0.263	TA2R7_MOUSE Taste receptor type 2 member 7 OS=Mus musculus OX=10090 GN=Tas2r7 PE=2 SV=1
10	Q9NYW4	5.36e-22	95.1	299	0.271	0.264	TA2R5_HUMAN Taste receptor type 2 member 5 OS=Homo sapiens OX=9606 GN=TAS2R5 PE=1 SV=1
11	Q9JKU1	1.94e-21	94.4	335	0.254	0.221	TR119_RAT Taste receptor type 2 member 119 OS=Rattus norvegicus OX=10116 GN=Tas2r119 PE=1 SV=1
12	Q2AB83	2.10e-21	94.0	311	0.278	0.260	T2R40_CHICK Taste receptor type 2 member 40 OS=Gallus gallus OX=9031 GN=TAS2R40 PE=1 SV=1
13	Q9JKE9	6.70e-21	92.4	312	0.268	0.250	TA2R7_RAT Taste receptor type 2 member 7 OS=Rattus norvegicus OX=10116 GN=Tas2r7 PE=1 SV=2
14	Q9NYW3	1.14e-20	92.0	318	0.234	0.214	TA2R7_HUMAN Taste receptor type 2 member 7 OS=Homo sapiens OX=9606 GN=TAS2R7 PE=1 SV=1
15	Q9NYW7	1.60e-20	91.3	299	0.285	0.278	TA2R1_HUMAN Taste receptor type 2 member 1 OS=Homo sapiens OX=9606 GN=TAS2R1 PE=1 SV=1
16	P59534	2.69e-20	91.3	338	0.265	0.228	T2R39_HUMAN Taste receptor type 2 member 39 OS=Homo sapiens OX=9606 GN=TAS2R39 PE=2 SV=3
17	Q9NYW2	1.47e-19	89.0	309	0.247	0.233	TA2R8_HUMAN Taste receptor type 2 member 8 OS=Homo sapiens OX=9606 GN=TAS2R8 PE=1 SV=1
18	Q9JKT2	1.90e-19	89.0	335	0.285	0.248	TR119_MOUSE Taste receptor type 2 member 119 OS=Mus musculus OX=10090 GN=Tas2r119 PE=1 SV=1
19	P59535	1.58e-18	86.3	323	0.244	0.220	T2R40_HUMAN Taste receptor type 2 member 40 OS=Homo sapiens OX=9606 GN=TAS2R40 PE=2 SV=1
20	Q9NYW6	8.07e-18	84.0	316	0.285	0.263	TA2R3_HUMAN Taste receptor type 2 member 3 OS=Homo sapiens OX=9606 GN=TAS2R3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05296 TAS2R	2.4e-85	297.9	Taste receptor protein (TAS2R)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249284

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448219	0.965	Taste receptor type 2 member 38
2	9606.ENSP00000364520	0.863	Taste receptor type 1 member 2
3	9606.ENSP00000331867	0.853	Taste receptor type 1 member 1
4	9606.ENSP00000344411	0.816	Taste receptor type 1 member 3
5	9606.ENSP00000420194	0.802	Extracellular calcium-sensing receptor
6	9606.ENSP00000368411	0.662	Amiloride-sensitive sodium channel subunit delta
7	9606.ENSP00000344489	0.660	E3 ubiquitin-protein ligase RNF133
8	9606.ENSP00000388207	0.656	Ring finger protein 148
9	9606.ENSP00000307259	0.651	P2Y purinoceptor 12
10	9606.ENSP00000440556	0.648	Metabotropic glutamate receptor 4
11	9606.ENSP00000366233	0.638	Gamma-aminobutyric acid type B receptor subunit 1
12	9606.ENSP00000381339	0.627	Guanine nucleotide-binding protein G(t) subunit alpha-3
13	9606.ENSP00000231188	0.626	Metabotropic glutamate receptor 6
14	9606.ENSP00000344173	0.625	Metabotropic glutamate receptor 8
15	9606.ENSP00000350348	0.625	Metabotropic glutamate receptor 7
16	9606.ENSP00000355316	0.625	Metabotropic glutamate receptor 3
17	9606.ENSP00000378492	0.625	Metabotropic glutamate receptor 2
18	9606.ENSP00000306678	0.621	Ankyrin repeat and kinase domain containing 1
19	9606.ENSP00000378359	0.602	Alcohol dehydrogenase 6
20	9606.ENSP00000259455	0.600	Gamma-aminobutyric acid type B receptor subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033038	1.000	bitter taste receptor activity
GO:0005515	0.975	protein binding
GO:0004930	0.710	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0051606	0.996	detection of stimulus
GO:0050912	0.987	detection of chemical stimulus involved in sensory perception of taste
GO:0050913	0.985	sensory perception of bitter taste
GO:0009987	0.972	cellular process
GO:0023052	0.835	signaling
GO:0065007	0.827	biological regulation
GO:0007154	0.799	cell communication
GO:0051716	0.780	cellular response to stimulus
GO:0050794	0.700	regulation of cellular process
GO:0007186	0.647	G protein-coupled receptor signaling pathway
GO:0001580	0.351	detection of chemical stimulus involved in sensory perception of bitter taste

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.325	intracellular membrane-bounded organelle
GO:0012505	0.312	endomembrane system
GO:0005737	0.308	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]