StarFunc result for job id Q9NYW8

User Input

>input (714 residues)
MNTLQGPVSFKDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLVSVGYDTTKPNVIIKL
EQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTLTEEKENTFSQ
IYMETSLVPSSIIAHNCVSCGKNLESISQLISSDGSYARTKPDECNECGKTYHGEKMCEF
NQNGDTYSHNEENILQKISILEKPFEYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGP
DFIQMSNFNAYQRSQMEMKPFECSECGKSFCKKSKFIIHQRAHTGEKPYECNVCGKSFSQ
KGTLTVHRRSHLEEKPYKCNECGKTFCQKLHLTQHLRTHSGEKPYECSECGKTFCQKTHL
TLHQRNHSGERPYPCNECGKSFSRKSALSDHQRTHTGEKLYKCNECGKSYYRKSTLITHQ
RTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHT
EEKSHECSECGKFSQLYLTDHHTAHLEEKPYECNECGKTFLVNSAFDGHQPLPKGEKSYE
CNVCGKLFNELSYYTEHYRSHSEEKPYGCSECGKTFSHNSSLFRHQRVHTGEKPYECYEC
GKFFSQKSYLTIHHRIHSGEKPYECSKCGKVFSRMSNLTVHYRSHSGEKPYECNECGKVF
SQKSYLTVHYRTHSGEKPYECNECGKKFHHRSAFNSHQRIHRRGNMNVLDVENL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYW8	1.000	1.000	0.000	714	1.000	1.000	Q9NYW8.pdb.gz	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
2	AFDB:P17014	0.323	0.330	4.374E-75	697	0.683	0.700	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
3	AFDB:Q5MCW4	0.346	0.360	3.666E-62	686	0.457	0.475	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
4	AFDB:Q06732	0.321	0.297	2.085E-61	778	0.521	0.478	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
5	AFDB:Q9HCZ1	0.336	0.350	4.841E-61	680	0.464	0.487	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
6	AFDB:Q14587	0.332	0.257	8.641E-61	947	0.489	0.369	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	AFDB:Q9P2J8	0.310	0.263	1.463E-60	865	0.461	0.380	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
8	AFDB:P51523	0.320	0.310	2.902E-60	738	0.466	0.451	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	AFDB:Q5TYW1	0.314	0.218	4.987E-59	1059	0.513	0.346	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
10	AFDB:Q6ECI4	0.303	0.302	1.675E-58	717	0.417	0.416	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	PDB:3w5kB	0.072	0.279	2.114E-4	110	0.059	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.046	0.239	1.018	96	0.022	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:8a5yT	0.066	0.071	1.018	650	0.067	0.074	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
14	PDB:4kfzB	0.047	0.138	1.257	148	0.043	0.209	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
15	PDB:6gejS	0.042	0.107	1.257	208	0.029	0.101	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:8ap8d	0.053	0.108	1.915	270	0.045	0.119	8ap8d.pdb.gz
17	PDB:7k1kA	0.106	0.037	2.243	3604	0.069	0.014	7k1kA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
18	PDB:7o4iW	0.055	0.096	2.243	312	0.048	0.109	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:5gm6a	0.030	0.111	2.492	123	0.028	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:7uhyC	0.053	0.059	3.077	578	0.036	0.045	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94892	0.0	532	652	0.434	0.475	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
2	P17014	0.0	929	697	0.686	0.703	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
3	P51523	0.0	627	738	0.486	0.470	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
4	P51814	0.0	584	821	0.448	0.390	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
5	P52742	0.0	535	658	0.430	0.467	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
6	Q06732	0.0	665	778	0.529	0.486	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
7	Q14587	0.0	552	947	0.403	0.304	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
8	Q5MCW4	0.0	619	686	0.482	0.501	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
9	Q5TYW1	0.0	548	1059	0.408	0.275	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
10	Q6ECI4	0.0	569	717	0.433	0.431	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	Q7TMN8	0.0	538	578	0.394	0.486	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
12	Q8BLA2	0.0	536	578	0.392	0.484	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
13	Q8N184	0.0	591	647	0.440	0.485	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
14	Q8TAQ5	0.0	592	688	0.454	0.471	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
15	Q96SK3	0.0	543	696	0.430	0.441	ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens OX=9606 GN=ZNF607 PE=1 SV=3
16	Q9HCZ1	0.0	595	680	0.459	0.482	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
17	Q9NYW8	0.0	1477	714	1.000	1.000	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
18	Q9P2J8	0.0	610	865	0.464	0.383	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
19	Q76KX8	1.31e-179	530	674	0.423	0.448	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
20	A0A0U1RQ46	2.82e-173	511	609	0.359	0.420	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	4.5e-20	82.3	KRAB box
2	PF01428 zf-AN1	90	14.6	AN1-like Zinc finger
3	PF00096 zf-C2H2	3.5e-73	249.3	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	8.7e-37	133.6	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	3.4e-15	66.8	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	0.0006	31.3	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	5.9e-92	309.6	Zinc-finger double domain
8	PF18439 zf_UBZ	52	14.9	Ubiquitin-Binding Zinc Finger
9	PF17032 zinc_ribbon_15	0.02	27.0	zinc-ribbon family
10	PF09723 Zn-ribbon_8	1e-09	49.7	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326967	0.671	Zinc finger protein 121
2	9606.ENSP00000267163	0.564	Retinoblastoma-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.612	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0048519	0.985	negative regulation of biological process
GO:0048523	0.967	negative regulation of cellular process
GO:0051172	0.936	negative regulation of nitrogen compound metabolic process
GO:0031324	0.932	negative regulation of cellular metabolic process
GO:0010605	0.923	negative regulation of macromolecule metabolic process
GO:0031327	0.878	negative regulation of cellular biosynthetic process
GO:0045892	0.865	negative regulation of DNA-templated transcription
GO:0048518	0.495	positive regulation of biological process
GO:0048522	0.472	positive regulation of cellular process
GO:0009987	0.469	cellular process
GO:0009893	0.416	positive regulation of metabolic process
GO:0031325	0.408	positive regulation of cellular metabolic process
GO:0010604	0.393	positive regulation of macromolecule metabolic process
GO:0051173	0.386	positive regulation of nitrogen compound metabolic process
GO:0006357	0.378	regulation of transcription by RNA polymerase II
GO:0045935	0.308	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.464	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]