StarFunc result for job id Q9NYY1

User Input

>input (176 residues)
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYY1	1.000	1.000	3.693E-27	176	1.000	1.000	Q9NYY1.pdb.gz	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
2	PDB:4dohA	0.866	0.996	4.343E-21	153	0.864	0.993	4dohA.pdb.gz
3	AFDB:Q9JKV9	0.878	0.878	3.097E-20	176	0.705	0.705	Q9JKV9.pdb.gz	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
4	AFDB:Q9UHD0	0.755	0.752	6.436E-11	177	0.381	0.379	Q9UHD0.pdb.gz	IL19_HUMAN Interleukin-19 OS=Homo sapiens OX=9606 GN=IL19 PE=1 SV=2
5	AFDB:Q8CJ70	0.772	0.772	1.227E-10	176	0.335	0.335	Q8CJ70.pdb.gz	IL19_MOUSE Interleukin-19 OS=Mus musculus OX=10090 GN=Il19 PE=2 SV=1
6	AFDB:Q13007	0.750	0.648	7.572E-9	206	0.312	0.267	Q13007.pdb.gz	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
7	AFDB:Q925S4	0.773	0.753	1.184E-8	181	0.307	0.298	Q925S4.pdb.gz	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
8	PDB:6gg1A	0.706	0.848	2.679E-8	145	0.335	0.407	6gg1A.pdb.gz
9	AFDB:Q9JI24	0.727	0.701	4.756E-8	183	0.278	0.268	Q9JI24.pdb.gz	IL24_RAT Interleukin-24 OS=Rattus norvegicus OX=10116 GN=Il24 PE=2 SV=1
10	PDB:6df3C	0.729	0.822	1.249E-7	155	0.273	0.310	6df3C.pdb.gz
11	AFDB:Q5EFQ8	0.646	0.633	2.362E-5	180	0.227	0.222	Q5EFQ8.pdb.gz	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
12	AFDB:P18893	0.617	0.611	6.070E-5	178	0.222	0.219	P18893.pdb.gz	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
13	AFDB:P43480	0.626	0.620	9.490E-5	178	0.188	0.185	P43480.pdb.gz	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
14	PDB:6weoQ	0.599	0.726	4.524E-4	142	0.142	0.176	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
15	PDB:1ykbD	0.547	0.658	2.573E-3	142	0.159	0.197	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
16	PDB:2ilkA	0.446	0.500	2.404E-2	155	0.210	0.239	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
17	PDB:1lqsL	0.406	0.490	3.759E-2	142	0.205	0.254	1lqsL.pdb.gz
18	PDB:4x51A	0.447	0.541	3.759E-2	142	0.227	0.282	4x51A.pdb.gz
19	PDB:1wu3I	0.418	0.443	7.170E-2	161	0.091	0.099	1wu3I.pdb.gz
20	PDB:3og6A	0.554	0.659	7.170E-2	143	0.091	0.112	3og6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NYY1	7.06e-131	365	176	1.000	1.000	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
2	Q9JKV9	1.63e-94	273	176	0.750	0.750	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
3	Q9UHD0	6.51e-41	137	177	0.398	0.395	IL19_HUMAN Interleukin-19 OS=Homo sapiens OX=9606 GN=IL19 PE=1 SV=2
4	Q8CJ70	9.68e-32	114	176	0.324	0.324	IL19_MOUSE Interleukin-19 OS=Mus musculus OX=10090 GN=Il19 PE=2 SV=1
5	Q925S4	1.44e-21	88.2	181	0.307	0.298	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
6	Q13007	3.60e-21	87.8	206	0.312	0.267	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
7	Q9JI24	1.43e-18	80.5	183	0.273	0.262	IL24_RAT Interleukin-24 OS=Rattus norvegicus OX=10116 GN=Il24 PE=2 SV=1
8	Q6A2H4	9.56e-15	70.5	175	0.250	0.251	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
9	P18893	9.17e-09	54.3	178	0.239	0.236	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
10	P29456	7.30e-08	52.0	178	0.233	0.230	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
11	Q5EFQ8	1.00e-07	51.6	180	0.188	0.183	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
12	Q6FGS9	6.44e-06	46.6	178	0.239	0.236	Q6FGS9_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
13	Q71UZ1	2.01e-05	44.7	160	0.244	0.269	Q71UZ1_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
14	P03180	2.69e-05	44.7	170	0.222	0.229	IL10H_EBVB9 Viral interleukin-10 homolog OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BCRF1 PE=1 SV=1
15	P22301	2.97e-05	44.7	178	0.244	0.242	IL10_HUMAN Interleukin-10 OS=Homo sapiens OX=9606 GN=IL10 PE=1 SV=1
16	Q6FGW4	2.97e-05	44.7	178	0.244	0.242	Q6FGW4_HUMAN Interleukin family protein OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
17	P43480	0.005	38.1	178	0.227	0.225	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
18	G0LWV4	0.060	35.0	173	0.170	0.173	G0LWV4_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il22 PE=2 SV=1
19	C5VUR1	0.079	34.7	173	0.170	0.173	C5VUR1_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il-22 PE=2 SV=1
20	Q6H8Q2	0.18	33.9	177	0.188	0.186	Q6H8Q2_SHEEP Interleukin family protein OS=Ovis aries OX=9940 GN=il10 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00726 IL10	1.3e-09	49.4	Interleukin 10

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314976	0.993	Interleukin-20 receptor subunit alpha
2	9606.ENSP00000328133	0.991	Interleukin-20 receptor subunit beta
3	9606.ENSP00000270800	0.923	Interleukin-22 receptor subunit alpha-1
4	9606.ENSP00000343000	0.821	Interleukin-19
5	9606.ENSP00000375795	0.819	Interleukin-24
6	9606.ENSP00000290200	0.688	Interleukin-10 receptor subunit beta
7	9606.ENSP00000343957	0.662	Interferon alpha/beta receptor 2
8	9606.ENSP00000296980	0.655	Interleukin-22 receptor subunit alpha-2
9	9606.ENSP00000290219	0.652	Interferon gamma receptor 2
10	9606.ENSP00000327824	0.652	Interferon lambda receptor 1
11	9606.ENSP00000270139	0.640	Interferon alpha/beta receptor 1
12	9606.ENSP00000264657	0.632	Signal transducer and activator of transcription 3
13	9606.ENSP00000356713	0.632	Interferon gamma receptor 1
14	9606.ENSP00000227752	0.627	Interleukin-10 receptor subunit alpha
15	9606.ENSP00000321345	0.626	Interleukin-23 receptor
16	9606.ENSP00000371067	0.625	Tyrosine-protein kinase JAK2
17	9606.ENSP00000391676	0.624	Tyrosine-protein kinase JAK3
18	9606.ENSP00000343204	0.623	Tyrosine-protein kinase JAK1
19	9606.ENSP00000363318	0.623	Cytokine receptor common subunit gamma
20	9606.ENSP00000370698	0.610	Interleukin-6 receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0045517	0.979	interleukin-20 receptor binding
GO:0048018	0.386	receptor ligand activity
GO:0005125	0.384	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0048522	0.982	positive regulation of cellular process
GO:0031325	0.966	positive regulation of cellular metabolic process
GO:0048583	0.891	regulation of response to stimulus
GO:0009987	0.886	cellular process
GO:0051239	0.881	regulation of multicellular organismal process
GO:0042325	0.877	regulation of phosphorylation
GO:0001932	0.870	regulation of protein phosphorylation
GO:0051247	0.857	positive regulation of protein metabolic process
GO:0051094	0.781	positive regulation of developmental process
GO:0010562	0.774	positive regulation of phosphorus metabolic process
GO:0050730	0.765	regulation of peptidyl-tyrosine phosphorylation
GO:0050896	0.739	response to stimulus
GO:0051240	0.732	positive regulation of multicellular organismal process
GO:0045595	0.705	regulation of cell differentiation
GO:0042327	0.648	positive regulation of phosphorylation
GO:0045597	0.646	positive regulation of cell differentiation
GO:2000026	0.558	regulation of multicellular organismal development
GO:0031401	0.531	positive regulation of protein modification process
GO:0001934	0.473	positive regulation of protein phosphorylation
GO:0030856	0.463	regulation of epithelial cell differentiation
GO:0032101	0.449	regulation of response to external stimulus
GO:0080134	0.424	regulation of response to stress
GO:0048584	0.407	positive regulation of response to stimulus
GO:0031347	0.392	regulation of defense response
GO:0051716	0.377	cellular response to stimulus
GO:0045682	0.362	regulation of epidermis development
GO:0042509	0.354	regulation of tyrosine phosphorylation of STAT protein
GO:0007165	0.334	signal transduction
GO:0050731	0.332	positive regulation of peptidyl-tyrosine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	0.547	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]