StarFunc result for job id Q9NYY3

User Input

>input (685 residues)
MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSSELKNRMEYALNMLLQRCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYY3	1.000	1.000	0.000	685	1.000	1.000	Q9NYY3.pdb.gz	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
2	AFDB:A6H8T5	0.459	0.478	1.770E-85	657	0.648	0.676	A6H8T5.pdb.gz	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
3	AFDB:Q9R011	0.462	0.488	2.236E-68	647	0.463	0.490	Q9R011.pdb.gz	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
4	AFDB:Q4FZD7	0.423	0.485	7.963E-55	595	0.327	0.376	Q4FZD7.pdb.gz	PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus OX=10090 GN=Plk5 PE=1 SV=1
5	AFDB:F7HSC1	0.415	0.470	7.271E-54	603	0.345	0.391	F7HSC1.pdb.gz	F7HSC1_MACMU Serine/threonine-protein kinase PLK OS=Macaca mulatta OX=9544 GN=PLK1 PE=3 SV=1
6	AFDB:Q4KMI8	0.418	0.481	1.996E-53	595	0.340	0.392	Q4KMI8.pdb.gz	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
7	AFDB:P52304	0.409	0.485	2.419E-53	576	0.312	0.372	P52304.pdb.gz	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2
8	AFDB:P70032	0.414	0.473	1.133E-51	598	0.345	0.395	P70032.pdb.gz	PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis OX=8355 GN=plk1 PE=1 SV=1
9	AFDB:P34331	0.409	0.432	6.745E-50	649	0.317	0.334	P34331.pdb.gz	PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans OX=6239 GN=plk-1 PE=1 SV=3
10	AFDB:Q9N2L7	0.417	0.452	1.682E-49	632	0.315	0.342	Q9N2L7.pdb.gz	PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans OX=6239 GN=plk-2 PE=1 SV=1
11	PDB:5u6yA	0.361	0.533	5.570E-22	459	0.142	0.211	5u6yA.pdb.gz
12	PDB:7myjC	0.354	0.514	7.799E-22	465	0.146	0.215	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
13	PDB:6b1uA	0.360	0.550	3.632E-21	442	0.149	0.231	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
14	PDB:4zhxA	0.356	0.587	9.970E-21	409	0.145	0.242	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:4c0tA	0.352	0.805	3.013E-20	291	0.115	0.271	4c0tA.pdb.gz
16	PDB:4rerA	0.363	0.537	7.881E-20	459	0.162	0.242	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5ufuA	0.355	0.646	3.498E-19	369	0.112	0.209	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:6byrA	0.362	0.603	6.229E-19	405	0.124	0.210	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
19	PDB:3pvuA	0.361	0.404	1.109E-18	609	0.133	0.149	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:4rewA	0.359	0.590	1.281E-18	411	0.145	0.241	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H8T5	0.0	931	657	0.658	0.686	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
2	P53351	0.0	1388	682	0.968	0.972	PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus OX=10090 GN=Plk2 PE=1 SV=1
3	Q60806	0.0	618	631	0.454	0.493	PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus OX=10090 GN=Plk3 PE=1 SV=2
4	Q9H4B4	0.0	629	646	0.454	0.481	PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens OX=9606 GN=PLK3 PE=1 SV=2
5	Q9NYY3	0.0	1440	685	1.000	1.000	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
6	Q9R011	0.0	627	647	0.458	0.485	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
7	Q9R012	0.0	1391	682	0.971	0.975	PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus OX=10116 GN=Plk2 PE=1 SV=1
8	Q6DRK7	3.79e-153	458	595	0.359	0.413	Q6DRK7_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk1 PE=1 SV=1
9	Q4KMI8	1.20e-152	456	595	0.358	0.412	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
10	Q07832	6.52e-150	450	603	0.353	0.401	PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus OX=10090 GN=Plk1 PE=1 SV=2
11	Q62673	2.23e-149	448	603	0.350	0.398	PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus OX=10116 GN=Plk1 PE=2 SV=2
12	Q4FZD7	2.31e-148	446	595	0.330	0.380	PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus OX=10090 GN=Plk5 PE=1 SV=1
13	F7HSC1	4.05e-146	440	603	0.352	0.400	F7HSC1_MACMU Serine/threonine-protein kinase PLK OS=Macaca mulatta OX=9544 GN=PLK1 PE=3 SV=1
14	P53350	5.49e-145	437	603	0.353	0.401	PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1
15	P70032	4.00e-141	427	598	0.346	0.396	PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis OX=8355 GN=plk1 PE=1 SV=1
16	P52304	1.22e-132	404	576	0.318	0.378	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2
17	P34331	1.12e-131	404	649	0.339	0.357	PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans OX=6239 GN=plk-1 PE=1 SV=3
18	P50528	2.10e-108	345	683	0.311	0.312	PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plo1 PE=1 SV=1
19	Q5ABG0	2.11e-98	318	653	0.301	0.315	Q5ABG0_CANAL Serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC5 PE=3 SV=1
20	P32562	2.43e-97	317	705	0.315	0.306	CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.8	17.8	ABC1 atypical kinase-like domain
2	PF01636 APH	6.3e+02	11.6	Phosphotransferase enzyme family
3	PF15991 G_path_suppress	32	16.1	G-protein pathway suppressor
4	PF14531 Kinase-like	2.6	18.9	Kinase-like
5	PF00069 Pkinase	9.6e-67	236.7	Protein kinase domain
6	PF17667 Pkinase_fungal	0.062	23.7	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	5e-35	132.6	Protein tyrosine and serine/threonine kinase
8	PF00659 POLO_box	1.7e-30	116.2	POLO box duplicated region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371308	0.959	Centromere protein J
2	9606.ENSP00000269305	0.946	Cellular tumor antigen p53
3	9606.ENSP00000296930	0.919	Nucleophosmin
4	9606.ENSP00000296509	0.918	Mitotic spindle assembly checkpoint protein MAD2A
5	9606.ENSP00000361540	0.917	Cell division cycle protein 20 homolog
6	9606.ENSP00000309968	0.902	Disintegrin and metalloproteinase domain-containing protein 17
7	9606.ENSP00000378699	0.891	Cyclin-dependent kinase 1
8	9606.ENSP00000302530	0.890	Mitotic checkpoint serine/threonine-protein kinase BUB1
9	9606.ENSP00000260731	0.868	Kinesin-like protein KIF11
10	9606.ENSP00000260363	0.856	Kinesin-like protein KIF23
11	9606.ENSP00000365210	0.853	G2/mitotic-specific cyclin-B3
12	9606.ENSP00000256442	0.849	G2/mitotic-specific cyclin-B1
13	9606.ENSP00000288207	0.822	G2/mitotic-specific cyclin-B2
14	9606.ENSP00000321656	0.812	M-phase inducer phosphatase 3
15	9606.ENSP00000338345	0.791	Alpha-synuclein
16	9606.ENSP00000365107	0.763	Serine/threonine-protein kinase greatwall
17	9606.ENSP00000364389	0.758	Dual specificity protein phosphatase CDC14B
18	9606.ENSP00000404190	0.755	Rac GTPase-activating protein 1
19	9606.ENSP00000430774	0.751	Uncharacterized protein
20	9606.ENSP00000261597	0.750	Kinetochore protein NDC80 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0042802	0.385	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0071704	0.989	organic substance metabolic process
GO:0048518	0.974	positive regulation of biological process
GO:0048523	0.968	negative regulation of cellular process
GO:0050896	0.962	response to stimulus
GO:0044237	0.954	cellular metabolic process
GO:0044238	0.952	primary metabolic process
GO:0006807	0.949	nitrogen compound metabolic process
GO:0043170	0.943	macromolecule metabolic process
GO:0019538	0.906	protein metabolic process
GO:0048522	0.896	positive regulation of cellular process
GO:0006468	0.891	protein phosphorylation
GO:0007049	0.883	cell cycle
GO:0019222	0.841	regulation of metabolic process
GO:0060255	0.826	regulation of macromolecule metabolic process
GO:0051716	0.822	cellular response to stimulus
GO:0080090	0.797	regulation of primary metabolic process
GO:0051171	0.797	regulation of nitrogen compound metabolic process
GO:0051246	0.763	regulation of protein metabolic process
GO:0007154	0.758	cell communication
GO:0009893	0.747	positive regulation of metabolic process
GO:0035556	0.747	intracellular signal transduction
GO:0048583	0.726	regulation of response to stimulus
GO:0009894	0.706	regulation of catabolic process
GO:0071840	0.677	cellular component organization or biogenesis
GO:0022402	0.664	cell cycle process
GO:0031323	0.659	regulation of cellular metabolic process
GO:0010646	0.657	regulation of cell communication
GO:0000278	0.654	mitotic cell cycle
GO:0023051	0.651	regulation of signaling
GO:1903047	0.625	mitotic cell cycle process
GO:0016043	0.608	cellular component organization
GO:0006996	0.487	organelle organization
GO:0065009	0.472	regulation of molecular function
GO:0010564	0.464	regulation of cell cycle process
GO:0010604	0.410	positive regulation of macromolecule metabolic process
GO:0009966	0.410	regulation of signal transduction
GO:0051173	0.408	positive regulation of nitrogen compound metabolic process
GO:0009896	0.384	positive regulation of catabolic process
GO:0051247	0.347	positive regulation of protein metabolic process
GO:0031325	0.341	positive regulation of cellular metabolic process
GO:0007346	0.339	regulation of mitotic cell cycle
GO:0000226	0.339	microtubule cytoskeleton organization
GO:0051128	0.331	regulation of cellular component organization
GO:0031329	0.310	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.992	cytosol
GO:0043228	0.989	non-membrane-bounded organelle
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0005856	0.887	cytoskeleton
GO:0032991	0.861	protein-containing complex
GO:0005694	0.834	chromosome
GO:0015630	0.832	microtubule cytoskeleton
GO:0005813	0.723	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]