StarFunc result for job id Q9NYZ3

User Input

>input (720 residues)
MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQP
PLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQ
ESKLKINLFEKEKEMKKSPTSLKRETYYLSDSPLLGPPVGEPRLLASSPALPSSGAQARL
TRAPGPPHSAHALPRESCTAHAASQAATQRKPGTKLLLPRAASVRGRSIPGAAEKPKKEI
PASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKA
PGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSNISKSGRMGPA
MLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSE
SSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDSPDSSTPKLSRAQRPQSCTS
VGRVTVHSTPVRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPMTPKTMPRAVGSPLCV
PARRRSSEPRKNSAMRTEPTRESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTF
SKSTATEVAREEAKPGGDAAPSEALLVDIKLEPLAVTPDAASQPLIDLPLIDFCDTPEAH
VAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYZ3	0.999	0.999	4.266E-92	720	1.000	1.000	Q9NYZ3.pdb.gz	GTSE1_HUMAN G2 and S phase-expressed protein 1 OS=Homo sapiens OX=9606 GN=GTSE1 PE=1 SV=3
2	AFDB:Q13061	0.055	0.055	7.303E-3	729	0.150	0.148	Q13061.pdb.gz	TRDN_HUMAN Triadin OS=Homo sapiens OX=9606 GN=TRDN PE=1 SV=4
3	AFDB:M9PEF2	0.055	0.051	8.893E-3	791	0.164	0.149	M9PEF2.pdb.gz	M9PEF2_DROME Liquid facets, isoform J OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
4	AFDB:Q9VQ58	0.061	0.048	1.408E-2	1023	0.190	0.134	Q9VQ58.pdb.gz	Q9VQ58_DROME FI15207p1 OS=Drosophila melanogaster OX=7227 GN=EMSY PE=1 SV=1
5	AFDB:P12036	0.055	0.043	2.087E-2	1026	0.149	0.104	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
6	AFDB:Q8IXK0	0.053	0.047	4.023E-2	858	0.174	0.146	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
7	AFDB:D4A6A8	0.059	0.044	4.296E-2	1042	0.168	0.116	D4A6A8.pdb.gz	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
8	AFDB:Q80YR6	0.054	0.045	5.230E-2	893	0.125	0.101	Q80YR6.pdb.gz	CTIP_MOUSE DNA endonuclease RBBP8 OS=Mus musculus OX=10090 GN=Rbbp8 PE=1 SV=1
9	AFDB:Q9VWE6	0.059	0.026	5.230E-2	2111	0.154	0.053	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
10	AFDB:Q9QX75	0.069	0.072	6.368E-2	687	0.138	0.144	Q9QX75.pdb.gz	TRDN_RAT Triadin OS=Rattus norvegicus OX=10116 GN=Trdn PE=1 SV=1
11	PDB:7mqaNA	0.038	0.086	3.263	295	0.032	0.078	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7w5a2	0.055	0.233	5.515	123	0.029	0.171	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:7ajtCL	0.054	0.051	6.715	781	0.025	0.023	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:4v6wCb	0.036	0.197	7.657	75	0.015	0.147	4v6wCb.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:5apny	0.047	0.146	7.657	211	0.008	0.028	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:2w0cP	0.044	0.374	8.176	65	0.015	0.169	2w0cP.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2
17	PDB:7mqaSI	0.058	0.053	9.323	803	0.021	0.019	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7wtwt	0.042	0.157	9.323	108	0.025	0.167	7wtwt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:7ajuCL	0.053	0.049	9.955	808	0.024	0.021	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7qsmZ	0.058	0.240	9.955	142	0.026	0.134	7qsmZ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NYZ3	0.0	1432	720	1.000	1.000	GTSE1_HUMAN G2 and S phase-expressed protein 1 OS=Homo sapiens OX=9606 GN=GTSE1 PE=1 SV=3
2	Q9D0P7	5.03e-04	45.4	329	0.067	0.146	PSRC1_MOUSE Proline/serine-rich coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Psrc1 PE=1 SV=2
3	Q6PGN9	0.022	40.0	363	0.061	0.121	PSRC1_HUMAN Proline/serine-rich coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=1
4	Q5T2Z1	0.036	38.9	231	0.061	0.190	Q5T2Z1_HUMAN Proline and serine rich coiled-coil 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=8
5	Q5T2Z0	0.073	37.7	205	0.058	0.205	Q5T2Z0_HUMAN Proline and serine rich coiled-coil 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15259 GTSE1_N	2.7e-62	220.7	G-2 and S-phase expressed 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288207	0.988	G2/mitotic-specific cyclin-B2
2	9606.ENSP00000378699	0.979	Cyclin-dependent kinase 1
3	9606.ENSP00000300093	0.976	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000256442	0.973	G2/mitotic-specific cyclin-B1
5	9606.ENSP00000361540	0.931	Cell division cycle protein 20 homolog
6	9606.ENSP00000361298	0.924	Kinesin-like protein KIF2C
7	9606.ENSP00000272317	0.903	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000304697	0.900	Polyubiquitin-B
9	9606.ENSP00000313950	0.900	Aurora kinase B
10	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
11	9606.ENSP00000441543	0.900	Polyubiquitin-C
12	9606.ENSP00000301633	0.898	Baculoviral IAP repeat containing 5
13	9606.ENSP00000378356	0.876	Kinesin-like protein KIF20A
14	9606.ENSP00000300403	0.873	Targeting protein for Xklp2
15	9606.ENSP00000274026	0.864	Cyclin-A2
16	9606.ENSP00000362146	0.863	Borealin
17	9606.ENSP00000216911	0.862	Aurora kinase A
18	9606.ENSP00000269305	0.861	Cellular tumor antigen p53
19	9606.ENSP00000247191	0.857	Disks large-associated protein 5
20	9606.ENSP00000342307	0.856	Forkhead box protein M1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0016043	0.989	cellular component organization
GO:0051726	0.967	regulation of cell cycle
GO:0051128	0.956	regulation of cellular component organization
GO:0007049	0.954	cell cycle
GO:0033043	0.950	regulation of organelle organization
GO:0006996	0.947	organelle organization
GO:0022402	0.913	cell cycle process
GO:0032886	0.894	regulation of microtubule-based process
GO:0070507	0.882	regulation of microtubule cytoskeleton organization
GO:0000278	0.865	mitotic cell cycle
GO:0010564	0.702	regulation of cell cycle process
GO:1903047	0.700	mitotic cell cycle process
GO:0048518	0.634	positive regulation of biological process
GO:0048522	0.614	positive regulation of cellular process
GO:0031323	0.525	regulation of cellular metabolic process
GO:0007059	0.524	chromosome segregation
GO:0000226	0.491	microtubule cytoskeleton organization
GO:0051171	0.480	regulation of nitrogen compound metabolic process
GO:0080090	0.469	regulation of primary metabolic process
GO:0060255	0.455	regulation of macromolecule metabolic process
GO:0009893	0.340	positive regulation of metabolic process
GO:0051276	0.326	chromosome organization
GO:0051179	0.315	localization
GO:0050790	0.306	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.999	membrane
GO:0005874	0.999	microtubule
GO:0005881	0.982	cytoplasmic microtubule
GO:0005819	0.583	spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]