StarFunc result for job id Q9NZ20

User Input

>input (509 residues)
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZ20	1.000	1.000	4.843E-95	509	1.000	1.000	Q9NZ20.pdb.gz	PA2G3_HUMAN Group 3 secretory phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G3 PE=1 SV=2
2	AFDB:Q8BZT7	0.510	0.515	7.467E-64	504	0.635	0.641	Q8BZT7.pdb.gz	PA2G3_MOUSE Group 3 secretory phospholipase A2 OS=Mus musculus OX=10090 GN=Pla2g3 PE=1 SV=1
3	AFDB:D3ZGN6	0.480	0.482	2.506E-63	506	0.642	0.646	D3ZGN6.pdb.gz	D3ZGN6_RAT Phospholipase A2, group III OS=Rattus norvegicus OX=10116 GN=Pla2g3 PE=4 SV=2
4	AFDB:P00630	0.210	0.601	2.372E-12	167	0.100	0.305	P00630.pdb.gz	PA2_APIME Phospholipase A2 OS=Apis mellifera OX=7460 PE=1 SV=3
5	AFDB:I7GQA7	0.203	0.547	1.236E-11	179	0.090	0.257	I7GQA7.pdb.gz	PA2_XYLAI Phospholipase A(2) OS=Xylocopa appendiculata circumvolans OX=135722 GN=PLA2 PE=1 SV=1
6	PDB:1pocA	0.212	0.776	1.529E-11	134	0.092	0.351	1pocA.pdb.gz	Crystal structure of bee-venom phospholipase A2 in a complex with a transition-state analogue.
7	AFDB:Q6AWR6	0.223	0.581	6.556E-9	186	0.077	0.210	Q6AWR6.pdb.gz	Q6AWR6_DROME RH74002p OS=Drosophila melanogaster OX=7227 GN=sPLA2 PE=2 SV=1
8	AFDB:Q8NCQ7	0.157	0.210	6.079E-5	364	0.108	0.151	Q8NCQ7.pdb.gz	PRCA1_HUMAN Protein PROCA1 OS=Homo sapiens OX=9606 GN=PROCA1 PE=1 SV=3
9	PDB:7kzpL	0.073	0.096	1.493E-1	370	0.029	0.041	7kzpL.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
10	AFDB:Q7DB77	0.087	0.081	1.875E-1	558	0.110	0.100	Q7DB77.pdb.gz	TIR_ECO57 Translocated intimin receptor Tir OS=Escherichia coli O157:H7 OX=83334 GN=tir PE=1 SV=1
11	AFDB:B9DFK5	0.078	0.088	1.981E-1	432	0.051	0.060	B9DFK5.pdb.gz	RETIC_ARATH Protein RETICULATA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RE PE=1 SV=1
12	AFDB:F1QMZ5	0.087	0.050	2.469E-1	1190	0.132	0.056	F1QMZ5.pdb.gz	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
13	PDB:5fgiH	0.048	0.093	1.209	234	0.031	0.068	5fgiH.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
14	PDB:6k5lA	0.076	0.070	1.349	565	0.026	0.023	6k5lA.pdb.gz	Characterization of metal binding of bifunctional kinase/phosphatase AceK and implication in activity modulation.
15	PDB:4rewA	0.065	0.077	1.426	411	0.020	0.024	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:1dw9A	0.050	0.114	1.592	156	0.028	0.090	1dw9A.pdb.gz
17	PDB:1u5kA	0.064	0.113	1.682	242	0.031	0.066	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
18	PDB:6a28A	0.048	0.092	1.682	238	0.029	0.063	6a28A.pdb.gz
19	PDB:7r7jB	0.090	0.082	1.682	574	0.031	0.028	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
20	PDB:6w6eI	0.057	0.074	1.777	357	0.026	0.036	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BZT7	0.0	634	504	0.646	0.653	PA2G3_MOUSE Group 3 secretory phospholipase A2 OS=Mus musculus OX=10090 GN=Pla2g3 PE=1 SV=1
2	Q9NZ20	0.0	1047	509	1.000	1.000	PA2G3_HUMAN Group 3 secretory phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G3 PE=1 SV=2
3	D3ZGN6	1.36e-147	432	462	0.444	0.489	D3ZGN6_RAT Phospholipase A2, group III OS=Rattus norvegicus OX=10116 GN=Pla2g3 PE=4 SV=2
4	P00630	4.17e-22	95.1	167	0.084	0.257	PA2_APIME Phospholipase A2 OS=Apis mellifera OX=7460 PE=1 SV=3
5	I7GQA7	6.10e-16	78.2	179	0.086	0.246	PA2_XYLAI Phospholipase A(2) OS=Xylocopa appendiculata circumvolans OX=135722 GN=PLA2 PE=1 SV=1
6	Q6PXP0	7.57e-13	68.6	157	0.063	0.204	PA2_ANUPH Phospholipase A2 phaiodactylipin OS=Anuroctonus phaiodactylus OX=246982 PE=1 SV=2
7	Q6AWR6	2.01e-09	59.3	186	0.061	0.167	Q6AWR6_DROME RH74002p OS=Drosophila melanogaster OX=7227 GN=sPLA2 PE=2 SV=1
8	Q6XPX3	2.07e-09	59.3	186	0.061	0.167	Q6XPX3_DROME FI07253p OS=Drosophila melanogaster OX=7227 GN=sPLA2 PE=2 SV=1
9	Q8NCQ7	3.78e-07	54.7	364	0.073	0.102	PRCA1_HUMAN Protein PROCA1 OS=Homo sapiens OX=9606 GN=PROCA1 PE=1 SV=3
10	P86780	4.87e-07	48.5	39	0.039	0.513	PA2_BUNCI Phospholipase A2 (Fragment) OS=Bunodosoma caissarum OX=31165 PE=1 SV=1
11	Q8SZB2	2.13e-06	48.5	101	0.041	0.208	Q8SZB2_DROME RE08605p OS=Drosophila melanogaster OX=7227 GN=sPLA2 PE=2 SV=1
12	Q6FP17	2.7	33.1	623	0.045	0.037	JJJ1_CANGA Negative regulator of PDR1-mediated fluconazole resistance JJJ1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=JJJ1 PE=4 SV=1
13	Q9P225	7.9	32.0	4427	0.045	0.005	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
14	P13590	9.9	31.6	1091	0.047	0.022	NCAM1_CHICK Neural cell adhesion molecule 1 OS=Gallus gallus OX=9031 GN=NCAM1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05535 Chromadorea_ALT	45	15.8	Chromadorea ALT protein
2	PF05826 Phospholip_A2_2	8.3e-39	143.0	Phospholipase A2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364246	0.960	Group IID secretory phospholipase A2
2	9606.ENSP00000243501	0.929	Group XIIA secretory phospholipase A2
3	9606.ENSP00000393847	0.926	Group 10 secretory phospholipase A2
4	9606.ENSP00000219345	0.910	Group XV phospholipase A2
5	9606.ENSP00000364243	0.870	Group IIF secretory phospholipase A2
6	9606.ENSP00000383364	0.870	Phospholipase A2, membrane associated
7	9606.ENSP00000364257	0.869	Group IIE secretory phospholipase A2
8	9606.ENSP00000364249	0.867	Calcium-dependent phospholipase A2
9	9606.ENSP00000315167	0.795	Arachidonate 12-lipoxygenase, 12R-type
10	9606.ENSP00000320337	0.784	HRAS-like suppressor 3
11	9606.ENSP00000312286	0.782	Phospholipase A2
12	9606.ENSP00000356438	0.780	Prostaglandin G/H synthase 2
13	9606.ENSP00000330442	0.769	Phospholipase B1, membrane-associated
14	9606.ENSP00000274793	0.765	Platelet-activating factor acetylhydrolase
15	9606.ENSP00000363512	0.741	Arachidonate 5-lipoxygenase
16	9606.ENSP00000387050	0.741	Phospholipase D3
17	9606.ENSP00000458832	0.716	Arachidonate 15-lipoxygenase
18	9606.ENSP00000363400	0.712	Platelet-activating factor acetylhydrolase 2, cytoplasmic
19	9606.ENSP00000333212	0.711	Cytochrome P450 2U1
20	9606.ENSP00000354612	0.710	Prostaglandin G/H synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047498	1.000	calcium-dependent phospholipase A2 activity
GO:0005488	0.743	binding
GO:0005515	0.626	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044255	0.989	cellular lipid metabolic process
GO:0051046	0.985	regulation of secretion
GO:0019637	0.985	organophosphate metabolic process
GO:0050776	0.983	regulation of immune response
GO:0060627	0.983	regulation of vesicle-mediated transport
GO:0051130	0.980	positive regulation of cellular component organization
GO:0002886	0.977	regulation of myeloid leukocyte mediated immunity
GO:0033003	0.977	regulation of mast cell activation
GO:1903532	0.977	positive regulation of secretion by cell
GO:0050729	0.977	positive regulation of inflammatory response
GO:0046470	0.976	phosphatidylcholine metabolic process
GO:0070925	0.974	organelle assembly
GO:0009893	0.973	positive regulation of metabolic process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0045921	0.971	positive regulation of exocytosis
GO:0051094	0.969	positive regulation of developmental process
GO:0031344	0.969	regulation of cell projection organization
GO:0002684	0.968	positive regulation of immune system process
GO:0002699	0.963	positive regulation of immune effector process
GO:0043300	0.957	regulation of leukocyte degranulation
GO:0030030	0.953	cell projection organization
GO:0043304	0.949	regulation of mast cell degranulation
GO:0023056	0.947	positive regulation of signaling
GO:0010647	0.947	positive regulation of cell communication
GO:0045723	0.947	positive regulation of fatty acid biosynthetic process
GO:0032501	0.946	multicellular organismal process
GO:0046883	0.946	regulation of hormone secretion
GO:0002696	0.946	positive regulation of leukocyte activation
GO:0043302	0.946	positive regulation of leukocyte degranulation
GO:0046471	0.856	phosphatidylglycerol metabolic process
GO:0009966	0.668	regulation of signal transduction
GO:0060255	0.641	regulation of macromolecule metabolic process
GO:0120035	0.607	regulation of plasma membrane bounded cell projection organization
GO:0010629	0.598	negative regulation of gene expression
GO:0120036	0.540	plasma membrane bounded cell projection organization
GO:0050896	0.513	response to stimulus
GO:0043933	0.476	protein-containing complex organization
GO:0044281	0.468	small molecule metabolic process
GO:0031346	0.453	positive regulation of cell projection organization
GO:0048523	0.448	negative regulation of cellular process
GO:0046887	0.410	positive regulation of hormone secretion
GO:0045597	0.408	positive regulation of cell differentiation
GO:0050778	0.407	positive regulation of immune response
GO:0060271	0.407	cilium assembly
GO:0044249	0.385	cellular biosynthetic process
GO:1901576	0.352	organic substance biosynthetic process
GO:0006631	0.335	fatty acid metabolic process
GO:0008610	0.325	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005615	0.995	extracellular space
GO:0005768	0.988	endosome
GO:0005815	0.986	microtubule organizing center
GO:0005814	0.983	centriole
GO:0055037	0.982	recycling endosome
GO:0016020	0.805	membrane
GO:0071944	0.709	cell periphery
GO:0031090	0.489	organelle membrane
GO:0005634	0.398	nucleus
GO:0005783	0.346	endoplasmic reticulum
GO:0031981	0.345	nuclear lumen
GO:0005829	0.331	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15801	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	1.000	phospholipase A2.

[back to server]