StarFunc result for job id Q9NZ52

User Input

>input (723 residues)
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYS
WTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDS
SDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
VINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPP
QASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL
QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAG
SSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPL
IPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVT
AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS
GTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQW
GNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZ52	1.000	1.000	1.479E-97	723	1.000	1.000	Q9NZ52.pdb.gz	GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
2	AFDB:A0A0G2JV04	0.554	0.551	3.509E-86	727	0.867	0.862	A0A0G2JV04.pdb.gz	GGA3_RAT ADP-ribosylation factor-binding protein GGA3 OS=Rattus norvegicus OX=10116 GN=Gga3 PE=1 SV=1
3	AFDB:Q9UJY5	0.345	0.382	1.280E-57	639	0.491	0.556	Q9UJY5.pdb.gz	GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 PE=1 SV=1
4	AFDB:Q9UJY4	0.311	0.352	1.101E-48	613	0.394	0.465	Q9UJY4.pdb.gz	GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3
5	AFDB:Q6P5E6	0.304	0.349	1.310E-47	603	0.380	0.456	Q6P5E6.pdb.gz	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
6	AFDB:F4JV51	0.203	0.216	2.597E-11	676	0.184	0.197	F4JV51.pdb.gz	F4JV51_ARATH ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=1 SV=1
7	AFDB:D3ZEY0	0.110	0.064	1.795E-6	1530	0.140	0.066	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
8	PDB:5a1uE	0.128	0.114	3.868E-4	824	0.030	0.027	5a1uE.pdb.gz
9	AFDB:A0A2R8QJD2	0.142	0.157	7.969E-4	644	0.141	0.158	A0A2R8QJD2.pdb.gz
10	AFDB:Q961B0	0.122	0.088	9.641E-4	1067	0.130	0.088	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
11	AFDB:Q6ZP82	0.082	0.050	1.283E-3	1450	0.131	0.066	Q6ZP82.pdb.gz	CC141_HUMAN Coiled-coil domain-containing protein 141 OS=Homo sapiens OX=9606 GN=CCDC141 PE=1 SV=3
12	PDB:7oo3c	0.165	0.750	2.599E-3	141	0.030	0.156	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
13	PDB:5voxP	0.125	0.181	6.735E-3	462	0.059	0.093	5voxP.pdb.gz
14	PDB:5nzrK	0.131	0.166	7.770E-3	560	0.028	0.036	5nzrK.pdb.gz
15	PDB:1qgkA	0.113	0.096	2.680E-2	876	0.055	0.046	1qgkA.pdb.gz
16	PDB:7p3xB	0.089	0.100	3.567E-2	621	0.068	0.079	7p3xB.pdb.gz
17	PDB:6xt9I	0.110	0.104	3.923E-2	767	0.018	0.017	6xt9I.pdb.gz
18	PDB:6k35A	0.095	0.105	4.746E-2	640	0.019	0.022	6k35A.pdb.gz	NAG-thiazoline is a potent inhibitor of the Vibrio campbellii GH20 beta-N-Acetylglucosaminidase.
19	PDB:7rroH7	0.121	0.144	4.978E-2	580	0.073	0.091	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:3zhpA	0.099	0.205	5.742E-2	315	0.053	0.121	3zhpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV04	0.0	1136	727	0.869	0.864	GGA3_RAT ADP-ribosylation factor-binding protein GGA3 OS=Rattus norvegicus OX=10116 GN=Gga3 PE=1 SV=1
2	J3KSS7	0.0	1226	632	0.851	0.973	J3KSS7_HUMAN Golgi associated, gamma adaptin ear containing, ARF binding protein 3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
3	Q8BMI3	0.0	1131	718	0.860	0.866	GGA3_MOUSE ADP-ribosylation factor-binding protein GGA3 OS=Mus musculus OX=10090 GN=Gga3 PE=1 SV=2
4	Q9NZ52	0.0	1455	723	1.000	1.000	GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
5	Q9UJY5	8.65e-146	442	639	0.317	0.358	GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 PE=1 SV=1
6	Q8R0H9	1.46e-145	441	635	0.307	0.350	GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus OX=10090 GN=Gga1 PE=1 SV=1
7	Q6P5E6	5.21e-102	327	603	0.238	0.285	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
8	Q9UJY4	3.73e-100	322	613	0.243	0.287	GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3
9	Q23165	6.49e-35	142	588	0.123	0.151	Q23165_CAEEL ADP-ribosylation factor-binding protein GGA1 OS=Caenorhabditis elegans OX=6239 GN=apt-9 PE=1 SV=2
10	Q9W329	3.23e-33	138	660	0.124	0.136	Q9W329_DROME Golgi-localized, gamma-adaptin ear containing, ARF binding protein OS=Drosophila melanogaster OX=7227 GN=Gga PE=1 SV=2
11	Q95RK8	4.13e-33	136	505	0.124	0.178	Q95RK8_DROME LD22310p OS=Drosophila melanogaster OX=7227 GN=Gga PE=2 SV=1
12	Q6ZVM7	5.00e-25	112	507	0.151	0.215	TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 PE=1 SV=1
13	O88746	2.25e-23	106	492	0.141	0.207	TOM1_MOUSE Target of Myb1 membrane trafficking protein OS=Mus musculus OX=10090 GN=Tom1 PE=1 SV=1
14	O60784	1.03e-21	101	492	0.120	0.177	TOM1_HUMAN Target of Myb1 membrane trafficking protein OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2
15	P38817	3.31e-17	88.2	585	0.127	0.157	GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GGA2 PE=1 SV=1
16	Q06336	1.13e-15	83.2	557	0.120	0.156	GGA1_YEAST ADP-ribosylation factor-binding protein GGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GGA1 PE=1 SV=1
17	Q8L860	5.37e-15	81.3	675	0.126	0.135	TOL9_ARATH TOM1-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=TOL9 PE=1 SV=1
18	F4JV51	5.92e-15	81.3	676	0.126	0.135	F4JV51_ARATH ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=1 SV=1
19	O75674	8.67e-15	79.7	476	0.155	0.235	TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2
20	A0A8I6A2K6	8.87e-15	80.1	545	0.066	0.088	A0A8I6A2K6_RAT Signal transducing adaptor molecule OS=Rattus norvegicus OX=10116 GN=Stam PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02883 Alpha_adaptinC2	7.7e-26	102.0	Adaptin C-terminal domain
2	PF11155 DUF2935	2.2e+02	13.7	Domain of unknown function (DUF2935)
3	PF03127 GAT	7.8e-16	69.4	GAT domain
4	PF18308 GGA_N-GAT	4.6e-18	75.9	N-terminal extension of GAT domain
5	PF17107 SesA	4.7e+02	12.3	N-terminal domain on NACHT_NTPase and P-loop NTPases
6	PF00790 VHS	9.4e-46	166.6	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.998	ADP-ribosylation factor 1
2	9606.ENSP00000298316	0.997	ADP-ribosylation factor 6
3	9606.ENSP00000349437	0.997	Cation-independent mannose-6-phosphate receptor
4	9606.ENSP00000445408	0.996	Rab GTPase-binding effector protein 1
5	9606.ENSP00000441543	0.979	Polyubiquitin-C
6	9606.ENSP00000311962	0.976	ADP-ribosylation factor-binding protein GGA2
7	9606.ENSP00000341344	0.975	ADP-ribosylation factor-binding protein GGA1
8	9606.ENSP00000000412	0.967	Cation-dependent mannose-6-phosphate receptor
9	9606.ENSP00000355651	0.946	Ras-related protein Rab-4A
10	9606.ENSP00000314615	0.938	ADP-ribosylation factor GTPase-activating protein 1
11	9606.ENSP00000309415	0.934	Clathrin light chain B
12	9606.ENSP00000318585	0.933	Beta-secretase 1
13	9606.ENSP00000242285	0.932	Clathrin light chain A
14	9606.ENSP00000349560	0.924	Ras-related protein Rab-4B
15	9606.ENSP00000357048	0.902	Coatomer subunit alpha
16	9606.ENSP00000244869	0.900	Proepiregulin
17	9606.ENSP00000272317	0.866	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000304697	0.847	Polyubiquitin-B
19	9606.ENSP00000300574	0.839	Adapter molecule crk
20	9606.ENSP00000317272	0.828	Hepatocyte growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.979	enzyme binding
GO:0031267	0.951	small GTPase binding
GO:0043130	0.938	ubiquitin binding
GO:0044877	0.880	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016192	0.993	vesicle-mediated transport
GO:0051641	0.989	cellular localization
GO:0050789	0.979	regulation of biological process
GO:0072665	0.906	protein localization to vacuole
GO:0098876	0.904	vesicle-mediated transport to the plasma membrane
GO:0051649	0.875	establishment of localization in cell
GO:0019222	0.869	regulation of metabolic process
GO:0046907	0.861	intracellular transport
GO:0060255	0.857	regulation of macromolecule metabolic process
GO:0006892	0.833	post-Golgi vesicle-mediated transport
GO:0051171	0.819	regulation of nitrogen compound metabolic process
GO:0080090	0.818	regulation of primary metabolic process
GO:0006893	0.800	Golgi to plasma membrane transport
GO:0016197	0.797	endosomal transport
GO:0072657	0.736	protein localization to membrane
GO:1990778	0.718	protein localization to cell periphery
GO:0051246	0.707	regulation of protein metabolic process
GO:0090150	0.662	establishment of protein localization to membrane
GO:0072659	0.661	protein localization to plasma membrane
GO:0061951	0.642	establishment of protein localization to plasma membrane
GO:0015031	0.635	protein transport
GO:0050794	0.577	regulation of cellular process
GO:0008152	0.506	metabolic process
GO:0048518	0.479	positive regulation of biological process
GO:0048519	0.456	negative regulation of biological process
GO:0071704	0.377	organic substance metabolic process
GO:0044238	0.335	primary metabolic process
GO:0006807	0.308	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.998	membrane
GO:0005768	0.997	endosome
GO:0098588	0.988	bounding membrane of organelle
GO:0005769	0.984	early endosome
GO:0010008	0.975	endosome membrane
GO:0032991	0.928	protein-containing complex
GO:0005829	0.920	cytosol
GO:0031984	0.887	organelle subcompartment
GO:0031901	0.767	early endosome membrane
GO:0005802	0.745	trans-Golgi network
GO:0000323	0.702	lytic vacuole
GO:0005764	0.588	lysosome
GO:0055037	0.562	recycling endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]