StarFunc result for job id Q9NZ56

User Input

>input (1722 residues)
MGNQDGKLKRSAGDALHEGGGGAEDALGPRDVEATKKGSGGKKALGKHGKGGGGGGGGGE
SGKKKSKSDSRASVFSNLRIRKNLSKGKGAGGSREDVLDSQALQTGELDSAHSLLTKTPD
LSLSADEAGLSDTECADPFEVTGPGGPGPAEARVGGRPIAEDVETAAGAQDGQRTSSGSD
TDIYSFHSATEQEDLLSDIQQAIRLQQQQQQQLQLQLQQQQQQQQLQGAEEPAAPPTAVS
PQPGAFLGLDRFLLGPSGGAGEAPGSPDTEQALSALSDLPESLAAEPREPQQPPSPGGLP
VSEAPSLPAAQPAAKDSPSSTAFPFPEAGPGEEAAGAPVRGAGDTDEEGEEDAFEDAPRG
SPGEEWAPEVGEDAPQRLGEEPEEEAQGPDAPAAASLPGSPAPSQRCFKPYPLITPCYIK
TTTRQLSSPNHSPSQSPNQSPRIKRRPEPSLSRGSRTALASVAAPAKKHRADGGLAAGLS
RSADWTEELGARTPRVGGSAHLLERGVASDSGGGVSPALAAKASGAPAAADGFQNVFTGR
TLLEKLFSQQENGPPEEAEKFCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFDQDQLYT
WAAVSQPTHSLDYSEGQFPRRVPSMGPPSKPPDEEHRLEDAETESQSAVSETPQKRSDAV
QKEVVDMKSEGQATVIQQLEQTIEDLRTKIAELERQYPALDTEVASGHQGLENGVTASGD
VCLEALRLEEKEVRHHRILEAKSIQTSPTEEGGVLTLPPVDGLPGRPPCPPGAESGPQTK
FCSEISLIVSPRRISVQLDSHQPTQSISQPPPPPSLLWSAGQGQPGSQPPHSISTEFQTS
HEHSVSSAFKNSCNIPSPPPLPCTESSSSMPGLGMVPPPPPPLPGMTVPTLPSTAIPQPP
PLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLP
GAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP
PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL
PGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGI
PPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPP
LPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVC
GFLPPPLPSGLFGLGMNQDKGSRKQPIEPCRPMKPLYWTRIQLHSKRDSSTSLIWEKIEE
PSIDCHEFEELFSKTAVKERKKPISDTISKTKAKQVVKLLSNKRSQAVGILMSSLHLDMK
DIQHAVVNLDNSVVDLETLQALYENRAQSDELEKIEKHGRSSKDKENAKSLDKPEQFLYE
LSLIPNFSERVFCILFQSTFSESICSIRRKLELLQKLCETLKNGPGVMQVLGLVLAFGNY
MNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLP
EPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFKENMEQFIIQA
KIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKEN
KLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JL04	0.303	0.328	0.000	1578	0.751	0.819	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
2	AFDB:Q9NZ56	1.000	1.000	0.000	1722	1.000	1.000	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	AFDB:Q05860	0.243	0.281	4.799E-38	1466	0.249	0.293	Q05860.pdb.gz	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
4	AFDB:Q8I3F9	0.172	0.114	3.056E-10	2675	0.137	0.088	Q8I3F9.pdb.gz	Q8I3F9_PLAF7 Formin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0530900 PE=4 SV=1
5	AFDB:O42854	0.031	0.032	4.144E-6	1611	0.161	0.172	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
6	AFDB:E1JI78	0.172	0.121	9.799E-6	2528	0.193	0.132	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
7	AFDB:A1Z9P3	0.054	0.057	4.747E-5	1576	0.135	0.147	A1Z9P3.pdb.gz	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
8	AFDB:Q6UB99	0.044	0.032	7.245E-4	2663	0.160	0.104	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
9	AFDB:Q13796	0.042	0.044	2.394E-3	1616	0.146	0.156	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
10	AFDB:B8A4S4	0.033	0.038	4.676E-3	1408	0.152	0.186	B8A4S4.pdb.gz	B8A4S4_DANRE Collagen, type XVII, alpha 1a OS=Danio rerio OX=7955 GN=si:ch211-281g13.3 PE=4 SV=1
11	PDB:3axyC	0.044	0.190	1.321E-1	235	0.019	0.140	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
12	PDB:4o9yA	0.036	0.027	2.706E-1	2490	0.019	0.013	4o9yA.pdb.gz
13	PDB:1qoyA	0.049	0.174	3.124E-1	303	0.027	0.152	1qoyA.pdb.gz
14	PDB:6k1zA	0.043	0.098	3.277E-1	544	0.026	0.083	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
15	PDB:7p54A	0.043	0.130	4.579E-1	397	0.032	0.139	7p54A.pdb.gz
16	PDB:7vgfA	0.043	0.098	5.816E-1	550	0.016	0.051	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
17	PDB:6yafB	0.031	0.061	6.100E-1	579	0.028	0.085	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
18	PDB:7nj1A	0.035	0.038	6.100E-1	1448	0.021	0.026	7nj1A.pdb.gz
19	PDB:7mq8SB	0.047	0.112	6.713E-1	440	0.030	0.116	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3lvsB	0.033	0.138	7.041E-1	274	0.019	0.120	3lvsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JL04	0.0	1095	1578	0.386	0.421	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
2	Q9NZ56	0.0	3338	1722	1.000	1.000	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	Q05860	4.56e-130	445	1466	0.131	0.154	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
4	Q24120	2.86e-81	294	1059	0.105	0.170	CAPU_DROME Protein cappuccino OS=Drosophila melanogaster OX=7227 GN=capu PE=1 SV=2
5	Q1ZXK2	2.18e-30	133	1074	0.069	0.111	FORG_DICDI Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1
6	A0A0R4IER9	4.98e-25	116	1060	0.064	0.104	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
7	Q54KF1	9.86e-24	112	1158	0.063	0.093	FORC_DICDI Formin-C OS=Dictyostelium discoideum OX=44689 GN=forC PE=1 SV=1
8	Q5TJ56	9.34e-23	108	1220	0.070	0.099	FORF_DICDI Formin-F OS=Dictyostelium discoideum OX=44689 GN=forF PE=1 SV=1
9	A0A1D5P556	1.13e-22	108	1075	0.065	0.104	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
10	Q9SE97	5.63e-20	99.8	1051	0.060	0.099	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
11	Q80U19	3.81e-19	97.1	1115	0.066	0.102	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
12	Q9C0D6	4.32e-18	93.6	1143	0.063	0.094	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
13	Q8BPM0	5.96e-18	93.2	1077	0.070	0.111	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
14	Q9FJX6	1.24e-17	92.0	899	0.052	0.100	FH6_ARATH Formin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=FH6 PE=2 SV=1
15	Q76LL6	3.41e-17	90.9	1578	0.056	0.061	FHOD3_MOUSE FH1/FH2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fhod3 PE=1 SV=1
16	F1LVW7	1.34e-16	89.0	1172	0.069	0.102	DIAP3_RAT Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4
17	Q0QWG9	1.46e-16	88.6	1203	0.053	0.076	GRD2I_MOUSE Delphilin OS=Mus musculus OX=10090 GN=Grid2ip PE=1 SV=1
18	F1LQJ2	1.62e-16	88.6	1578	0.056	0.061	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
19	O22824	2.01e-16	87.8	894	0.040	0.077	FH2_ARATH Formin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FH2 PE=3 SV=1
20	Q3ULZ2	2.96e-16	87.8	1149	0.060	0.091	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	7.1e+02	11.7	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF06346 Drf_FH1	1.5e-12	59.1	Formin Homology Region 1
3	PF02181 FH2	4.5e-96	333.9	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318884

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387266	0.989	Protein spire homolog 1
2	9606.ENSP00000367494	0.880	Protein spire homolog 2
3	9606.ENSP00000355523	0.737	Regulator of G-protein signaling 7
4	9606.ENSP00000285039	0.728	Unconventional myosin-Vb
5	9606.ENSP00000400175	0.660	Transforming protein RhoA
6	9606.ENSP00000239940	0.633	Profilin-2
7	9606.ENSP00000383118	0.632	Cell division control protein 42 homolog
8	9606.ENSP00000385312	0.631	Mitochondrial thiamine pyrophosphate carrier
9	9606.ENSP00000379441	0.614	Junction-mediating and -regulatory protein
10	9606.ENSP00000225655	0.610	Profilin-1
11	9606.ENSP00000383178	0.589	Protein diaphanous homolog 3
12	9606.ENSP00000477613	0.559	Baculoviral IAP repeat-containing protein 2
13	9606.ENSP00000263464	0.547	Baculoviral IAP repeat-containing protein 3
14	9606.ENSP00000353590	0.540	Myosin-10
15	9606.ENSP00000365891	0.533	Wiskott-Aldrich syndrome protein
16	9606.ENSP00000355492	0.529	Cation channel sperm-associated protein subunit epsilon
17	9606.ENSP00000223023	0.528	Neural Wiskott-Aldrich syndrome protein
18	9606.ENSP00000300896	0.526	Ubiquitin specific peptidase 32
19	9606.ENSP00000401878	0.524	Kelch repeat and BTB domain-containing protein 8
20	9606.ENSP00000375063	0.521	NACHT, LRR and PYD domains-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0030029	0.986	actin filament-based process
GO:0030036	0.983	actin cytoskeleton organization
GO:0050789	0.978	regulation of biological process
GO:0022607	0.977	cellular component assembly
GO:0050794	0.968	regulation of cellular process
GO:0007015	0.963	actin filament organization
GO:0061572	0.925	actin filament bundle organization
GO:0051017	0.907	actin filament bundle assembly
GO:0048522	0.897	positive regulation of cellular process
GO:0050896	0.869	response to stimulus
GO:0051716	0.740	cellular response to stimulus
GO:0019222	0.715	regulation of metabolic process
GO:0060255	0.698	regulation of macromolecule metabolic process
GO:0051171	0.634	regulation of nitrogen compound metabolic process
GO:0048583	0.626	regulation of response to stimulus
GO:0080090	0.624	regulation of primary metabolic process
GO:0031323	0.623	regulation of cellular metabolic process
GO:0010604	0.513	positive regulation of macromolecule metabolic process
GO:0051173	0.407	positive regulation of nitrogen compound metabolic process
GO:0048584	0.382	positive regulation of response to stimulus
GO:0019219	0.379	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.375	positive regulation of cellular metabolic process
GO:0048523	0.367	negative regulation of cellular process
GO:0045935	0.355	positive regulation of nucleobase-containing compound metabolic process
GO:0080134	0.349	regulation of response to stress
GO:0006950	0.323	response to stress
GO:0051246	0.302	regulation of protein metabolic process
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	1.000	cytoskeleton
GO:0005829	0.999	cytosol
GO:0031981	0.996	nuclear lumen
GO:0015629	0.958	actin cytoskeleton
GO:0016020	0.941	membrane
GO:0071944	0.825	cell periphery
GO:0005730	0.769	nucleolus
GO:0012505	0.608	endomembrane system
GO:0005654	0.485	nucleoplasm
GO:0005886	0.405	plasma membrane
GO:0015630	0.326	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]