StarFunc result for job id Q9NZ63

User Input

>input (289 residues)
MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQE
ETTLVDDPFQMKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIE
TELKKRKGIVEHEEQKVKPKNAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGI
DAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNRFYHEELNAPIRRNK
EEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYEKFKKMNRRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZ63	1.000	1.000	6.619E-43	289	1.000	1.000	Q9NZ63.pdb.gz	TLS1_HUMAN Splicing factor C9orf78 OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1
2	AFDB:F4HVZ5	0.186	0.191	6.732E-6	279	0.304	0.315	F4HVZ5.pdb.gz	CSU2_ARATH Protein COP1 SUPPRESSOR 2 OS=Arabidopsis thaliana OX=3702 GN=CSU2 PE=1 SV=1
3	PDB:7os2C	0.136	0.557	8.181E-4	54	0.187	1.000	7os2C.pdb.gz
4	AFDB:O44158	0.120	0.144	1.060	234	0.131	0.162	O44158.pdb.gz	O44158_CAEEL VPS37 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vps-37 PE=1 SV=1
5	AFDB:Q3SY00	0.094	0.060	1.572	556	0.138	0.072	Q3SY00.pdb.gz	T10IP_HUMAN Testis-specific protein 10-interacting protein OS=Homo sapiens OX=9606 GN=TSGA10IP PE=1 SV=2
6	AFDB:Q01850	0.150	0.108	1.915	454	0.145	0.093	Q01850.pdb.gz	CDR2_HUMAN Cerebellar degeneration-related protein 2 OS=Homo sapiens OX=9606 GN=CDR2 PE=1 SV=2
7	AFDB:P48997	0.110	0.074	2.491	467	0.111	0.069	P48997.pdb.gz	INVO_MOUSE Involucrin OS=Mus musculus OX=10090 GN=Ivl PE=1 SV=1
8	PDB:7o4i1	0.112	0.074	2.661	522	0.111	0.061	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
9	AFDB:O14012	0.105	0.152	2.841	203	0.125	0.177	O14012.pdb.gz	RRP17_SCHPO Ribosomal RNA-processing protein 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp17 PE=3 SV=1
10	AFDB:Q4WK23	0.119	0.040	3.034	1068	0.159	0.043	Q4WK23.pdb.gz	Q4WK23_ASPFU Eukaryotic translation initiation factor 5B OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G03970 PE=3 SV=1
11	AFDB:Q9LV31	0.102	0.050	3.034	847	0.128	0.044	Q9LV31.pdb.gz	Q9LV31_ARATH Myb domain protein 4r1 OS=Arabidopsis thaliana OX=3702 GN=MYB4R1 PE=2 SV=1
12	AFDB:O43009	0.085	0.096	3.461	248	0.125	0.145	O43009.pdb.gz	MU110_SCHPO Meiotically up-regulated gene 110 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug110 PE=1 SV=1
13	PDB:6qdvO	0.099	0.071	4.809	441	0.145	0.095	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
14	PDB:7ajtCK	0.090	0.122	7.135	207	0.069	0.097	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:6j6gA	0.096	0.018	8.138	1913	0.076	0.012	6j6gA.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZ63	0.0	587	289	1.000	1.000	TLS1_HUMAN Splicing factor C9orf78 OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1
2	F4HVZ5	9.68e-18	83.2	279	0.284	0.294	CSU2_ARATH Protein COP1 SUPPRESSOR 2 OS=Arabidopsis thaliana OX=3702 GN=CSU2 PE=1 SV=1
3	F4I4Q9	8.5	30.0	229	0.045	0.057	F4I4Q9_ARATH Calcyclin-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g30070 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07052 Hep_59	3.7e-25	100.0	Hepatocellular carcinoma-associated antigen 59

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021428

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009391	0.692	Transmembrane protein 230

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030623	1.000	U5 snRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0010467	0.986	gene expression
GO:0016070	0.986	RNA metabolic process
GO:0008380	0.983	RNA splicing
GO:0006397	0.966	mRNA processing
GO:0050794	0.962	regulation of cellular process
GO:0000377	0.947	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.942	mRNA splicing, via spliceosome
GO:0010564	0.836	regulation of cell cycle process
GO:0045292	0.734	mRNA cis splicing, via spliceosome
GO:2000241	0.665	regulation of reproductive process
GO:0051983	0.648	regulation of chromosome segregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0098687	0.985	chromosomal region
GO:0000775	0.983	chromosome, centromeric region
GO:0032991	0.399	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]