StarFunc result for job id Q9NZ71

User Input

>input (1219 residues)
MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWR
EHLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLT
QVINELRNTSYRPKVCVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRSCHFYNNVEE
KSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNI
DLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFS
ADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVTKPGSYIFELFAEAQITFQ
TKGCILDSLDQIIQHLAGRAGVFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGLGALQS
YKVHIHPDAGHRRTAQRSDAWSTTAARKRGKVLSYWCFSPGHSMHELVRQGVRSLILTSG
TLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSS
LGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSE
TISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKM
QFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADA
RAQLPSWVRPHVRVYDNFGHVIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSP
GPFFSTRKAKSLDLHVPSLKQRSSGSPAAGDPESSLCVEYEQEPVPARQRPRGLLAALEH
SEQRAGSPGEEQAHSCSTLSLLSEKRPAEEPRGGRKKIRLVSHPEEPVAGAQTDRAKLFM
VAVKQELSQANFATFTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRPHH
KQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQE
HLNQGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRALGSAGCSQLL
AALTAYKQDDDLDKVLAVLAALTTAKPEDFPLLHRFSMFVRPHHKQRFSQTCTDLTGRPY
PGMEPPGPQEERLAVPPVLTHRAPQPGPSRSEKTGKTQSKISSFLRQRPAGTVGAGGEDA
GPSQSSGPPHGPAASEWGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VGM9	0.658	0.666	0.000	1203	0.746	0.756	Q0VGM9.pdb.gz	RTEL1_MOUSE Regulator of telomere elongation helicase 1 OS=Mus musculus OX=10090 GN=Rtel1 PE=1 SV=2
2	AFDB:Q9NZ71	0.999	0.999	0.000	1219	1.000	1.000	Q9NZ71.pdb.gz	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
3	AFDB:Q9W484	0.572	0.699	3.544E-72	985	0.299	0.371	Q9W484.pdb.gz	RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Rtel1 PE=1 SV=1
4	AFDB:Q93575	0.533	0.649	2.728E-63	994	0.246	0.302	Q93575.pdb.gz	RTEL1_CAEEL Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rtel-1 PE=3 SV=3
5	AFDB:Q9BX63	0.501	0.490	4.035E-53	1249	0.215	0.210	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
6	AFDB:F1R345	0.468	0.632	2.745E-46	890	0.172	0.236	F1R345.pdb.gz	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
7	AFDB:O14147	0.487	0.692	1.411E-45	844	0.168	0.243	O14147.pdb.gz	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
8	AFDB:Q55G81	0.483	0.746	1.235E-42	776	0.150	0.236	Q55G81.pdb.gz	ERCC2_DICDI General transcription and DNA repair factor IIH helicase subunit XPD OS=Dictyostelium discoideum OX=44689 GN=repD PE=2 SV=1
9	AFDB:D3ZEG9	0.490	0.770	1.698E-42	760	0.152	0.243	D3ZEG9.pdb.gz	D3ZEG9_RAT General transcription and DNA repair factor IIH helicase subunit XPD OS=Rattus norvegicus OX=10116 GN=Ercc2 PE=3 SV=1
10	AFDB:Q8W4M7	0.494	0.780	3.850E-42	758	0.148	0.237	Q8W4M7.pdb.gz	ERCC2_ARATH General transcription and DNA repair factor IIH helicase subunit XPD OS=Arabidopsis thaliana OX=3702 GN=XPD PE=1 SV=1
11	PDB:7ad8B	0.492	0.867	1.852E-37	675	0.148	0.267	7ad8B.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:7lbmX	0.485	0.760	4.541E-35	760	0.152	0.243	7lbmX.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
13	PDB:7k010	0.484	0.764	3.738E-33	754	0.145	0.235	7k010.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
14	PDB:5fmfY	0.390	0.771	2.059E-25	578	0.111	0.234	5fmfY.pdb.gz	Structure of an RNA Polymerase II Pre-Initiation Complex
15	PDB:5svaY	0.384	0.782	1.253E-22	562	0.116	0.253	5svaY.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
16	PDB:6fwrA	0.373	0.614	1.887E-22	699	0.092	0.160	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
17	PDB:3crvA	0.329	0.659	1.484E-20	551	0.108	0.240	3crvA.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
18	PDB:3crw1	0.284	0.641	3.653E-15	485	0.097	0.243	3crw1.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
19	PDB:7oo3b	0.179	0.364	5.315E-6	534	0.067	0.154	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
20	PDB:3uwxB	0.214	0.382	4.113E-5	595	0.081	0.166	3uwxB.pdb.gz	Structure and mechanism of the UvrA-UvrB DNA damage sensor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VGM9	0.0	1835	1203	0.748	0.758	RTEL1_MOUSE Regulator of telomere elongation helicase 1 OS=Mus musculus OX=10090 GN=Rtel1 PE=1 SV=2
2	Q9NZ71	0.0	2513	1219	1.000	1.000	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
3	Q9W484	0.0	632	985	0.312	0.386	RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Rtel1 PE=1 SV=1
4	F4HQE2	1.50e-180	561	1040	0.295	0.345	RTEL1_ARATH Regulator of telomere elongation helicase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=RTEL1 PE=3 SV=1
5	Q93575	8.77e-133	433	994	0.221	0.272	RTEL1_CAEEL Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rtel-1 PE=3 SV=3
6	Q3YK19	1.88e-96	338	1252	0.187	0.182	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
7	F1R345	3.74e-67	246	890	0.158	0.216	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
8	F4HUN4	1.47e-63	239	1175	0.110	0.114	F4HUN4_ARATH RAD3-like DNA-binding helicase protein OS=Arabidopsis thaliana OX=3702 GN=At1g20720 PE=1 SV=1
9	Q9BX63	1.05e-61	233	1249	0.098	0.095	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
10	Q5SXJ3	2.43e-61	232	1174	0.114	0.118	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
11	A0A0G2K475	1.61e-60	229	1166	0.110	0.115	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
12	A8MPP1	2.63e-58	220	907	0.156	0.209	D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens OX=9606 GN=DDX11L8 PE=1 SV=1
13	O08811	1.03e-54	207	760	0.171	0.275	ERCC2_MOUSE General transcription and DNA repair factor IIH helicase subunit XPD OS=Mus musculus OX=10090 GN=Ercc2 PE=1 SV=2
14	P26659	1.76e-54	206	772	0.161	0.254	RAD15_SCHPO General transcription and DNA repair factor IIH helicase subunit XPD OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad15 PE=1 SV=2
15	Q55G81	4.32e-53	202	776	0.156	0.245	ERCC2_DICDI General transcription and DNA repair factor IIH helicase subunit XPD OS=Dictyostelium discoideum OX=44689 GN=repD PE=2 SV=1
16	Q57YJ9	1.73e-50	195	819	0.164	0.244	Q57YJ9_TRYB2 General transcription and DNA repair factor IIH helicase subunit XPD OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.890 PE=3 SV=1
17	A0A1D8PQH0	3.90e-48	187	765	0.155	0.247	A0A1D8PQH0_CANAL ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD3 PE=3 SV=1
18	Q96FC9	1.20e-47	187	970	0.132	0.166	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
19	O14147	5.03e-46	181	844	0.078	0.113	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
20	O62217	4.53e-44	176	983	0.080	0.100	O62217_CAEEL DNA helicase OS=Caenorhabditis elegans OX=6239 GN=dog-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16545 CCM2_C	1.9	20.3	Cerebral cavernous malformation protein, harmonin-homology
2	PF00270 DEAD	0.22	22.8	DEAD/DEAH box helicase
3	PF06733 DEAD_2	2.3e-53	191.9	DEAD_2
4	PF06679 DUF1180	7e+02	12.0	Protein of unknown function (DUF1180)
5	PF13307 Helicase_C_2	7.1e-50	181.0	Helicase C-terminal domain
6	PF04851 ResIII	0.00022	32.8	Type III restriction enzyme, res subunit
7	PF00176 SNF2-rel_dom	32	14.9	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412698	0.996	MMS19 nucleotide excision repair protein homolog
2	9606.ENSP00000298139	0.981	Werner syndrome ATP-dependent helicase
3	9606.ENSP00000372088	0.975	DNA repair protein RAD51 homolog 1
4	9606.ENSP00000387471	0.974	Mitotic spindle-associated MMXD complex subunit MIP18
5	9606.ENSP00000328174	0.973	ATP-dependent DNA helicase PIF1
6	9606.ENSP00000347232	0.971	Bloom syndrome protein
7	9606.ENSP00000351185	0.970	DNA replication ATP-dependent helicase/nuclease DNA2
8	9606.ENSP00000355506	0.969	Exonuclease 1
9	9606.ENSP00000276603	0.966	Telomeric repeat-binding factor 1
10	9606.ENSP00000418287	0.965	Probable cytosolic iron-sulfur protein assembly protein CIAO1
11	9606.ENSP00000442336	0.964	DNA topoisomerase 3-alpha
12	9606.ENSP00000317039	0.956	RecQ-mediated genome instability protein 1
13	9606.ENSP00000418960	0.956	Breast cancer type 1 susceptibility protein
14	9606.ENSP00000369497	0.953	Breast cancer type 2 susceptibility protein
15	9606.ENSP00000451974	0.950	DNA repair protein XRCC3
16	9606.ENSP00000278616	0.948	Serine-protein kinase ATM
17	9606.ENSP00000310356	0.946	RecQ-mediated genome instability protein 2
18	9606.ENSP00000251588	0.945	Cytosolic Fe-S cluster assembly factor NARFL
19	9606.ENSP00000283027	0.942	Cytosolic Fe-S cluster assembly factor NUBP1
20	9606.ENSP00000336701	0.942	DNA repair protein RAD51 homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035639	1.000	purine ribonucleoside triphosphate binding
GO:0003678	1.000	DNA helicase activity
GO:0032555	0.997	purine ribonucleotide binding
GO:0005524	0.993	ATP binding
GO:0019899	0.394	enzyme binding
GO:0003676	0.391	nucleic acid binding
GO:0003677	0.354	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043170	0.988	macromolecule metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0032200	0.986	telomere organization
GO:0000723	0.979	telomere maintenance
GO:0033043	0.976	regulation of organelle organization
GO:2001020	0.973	regulation of response to DNA damage stimulus
GO:0000018	0.973	regulation of DNA recombination
GO:0032204	0.964	regulation of telomere maintenance
GO:0051053	0.956	negative regulation of DNA metabolic process
GO:0051130	0.946	positive regulation of cellular component organization
GO:0051054	0.942	positive regulation of DNA metabolic process
GO:0010638	0.919	positive regulation of organelle organization
GO:2001252	0.900	positive regulation of chromosome organization
GO:0051129	0.891	negative regulation of cellular component organization
GO:0006310	0.884	DNA recombination
GO:0032206	0.882	positive regulation of telomere maintenance
GO:0006282	0.822	regulation of DNA repair
GO:0044087	0.732	regulation of cellular component biogenesis
GO:0050896	0.675	response to stimulus
GO:0033554	0.498	cellular response to stress
GO:2000779	0.440	regulation of double-strand break repair
GO:1904356	0.436	regulation of telomere maintenance via telomere lengthening
GO:0006974	0.414	cellular response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.960	protein-containing complex
GO:0043232	0.912	intracellular non-membrane-bounded organelle
GO:0005694	0.718	chromosome
GO:0098687	0.631	chromosomal region
GO:0000781	0.512	chromosome, telomeric region
GO:0140513	0.345	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]