StarFunc result for job id Q9NZB8

User Input

>input (636 residues)
MAARPLSRMLRRLLRSSARSCSSGAPVTQPCPGESARAASEEVSRRRQFLREHAAPFSAF
LTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKEGID
KIRLTGGEPLIRPDVVDIVAQLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLD
TLVPAKFEFIVRRKGFHKVMEGIHKAIELGYNPVKVNCVVMRGLNEDELLDFAALTEGLP
LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQ
ISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVG
RKKRQHAGMFSISQMKNRPMILIELFLMFPNSPPANPSIFSWDPLHVQGLRPRMSFSSQV
ATLWKGCRVPQTPPLAQQRLGSGSFQRHYTSRADSDANSKCLSPGSWASAAPSGPQLTSE
QLTHVDSEGRAAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAG
VQAAKVTSQLIPLCHHVALSHIQVQLELDSTRHAVKIQASCRARGPTGVEMEALTSAAVA
ALTLYDMCKAVSRDIVLEEIKLISKTGGQRGDFHRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5RKZ7	0.830	0.830	0.000	636	0.847	0.847	Q5RKZ7.pdb.gz	MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus OX=10090 GN=Mocs1 PE=1 SV=2
2	AFDB:Q9NZB8	1.000	1.000	0.000	636	1.000	1.000	Q9NZB8.pdb.gz	MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens OX=9606 GN=MOCS1 PE=1 SV=3
3	AFDB:Q8IQF1	0.490	0.551	8.621E-72	565	0.467	0.526	Q8IQF1.pdb.gz	MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster OX=7227 GN=Mocs1 PE=2 SV=1
4	AFDB:G5EAS9	0.520	0.477	4.553E-70	694	0.451	0.414	G5EAS9.pdb.gz	G5EAS9_EMENI Radical SAM core domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00947 PE=3 SV=1
5	AFDB:Q39055	0.522	0.850	6.625E-54	390	0.332	0.541	Q39055.pdb.gz	CNX2_ARATH GTP 3',8-cyclase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX2 PE=1 SV=1
6	AFDB:Q72EJ8	0.492	0.903	1.060E-32	341	0.193	0.361	Q72EJ8.pdb.gz	Q72EJ8_DESVH GTP 3',8-cyclase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=moaA PE=1 SV=1
7	AFDB:P9WJS1	0.484	0.840	9.208E-30	360	0.193	0.342	P9WJS1.pdb.gz	MOAA2_MYCTU GTP 3',8-cyclase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaA2 PE=1 SV=1
8	AFDB:P30745	0.477	0.899	2.342E-29	329	0.187	0.362	P30745.pdb.gz	MOAA_ECOLI GTP 3',8-cyclase OS=Escherichia coli (strain K12) OX=83333 GN=moaA PE=1 SV=1
9	AFDB:Q39056	0.242	0.569	2.437E-22	270	0.121	0.285	Q39056.pdb.gz	CNX3_ARATH Cyclic pyranopterin monophosphate synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX3 PE=1 SV=1
10	AFDB:P0A738	0.245	0.957	2.664E-21	161	0.116	0.460	P0A738.pdb.gz	MOAC_ECOLI Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12) OX=83333 GN=moaC PE=1 SV=2
11	PDB:4pydC	0.239	0.966	2.612E-19	154	0.115	0.474	4pydC.pdb.gz	Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
12	PDB:1r30B	0.260	0.487	5.682E-7	313	0.072	0.147	1r30B.pdb.gz	Crystal structure of biotin synthase, an S-adenosylmethionine-dependent radical enzyme.
13	PDB:3t7vA	0.267	0.474	1.825E-6	337	0.071	0.134	3t7vA.pdb.gz	Crystal structure of methylornithine synthase (PylB): insights into the pyrrolysine biosynthesis.
14	PDB:1oltA	0.269	0.372	2.443E-6	434	0.069	0.101	1oltA.pdb.gz	Crystal Structure of Coproporphyrinogen III Oxidase Reveals Cofactor Geometry of Radical Sam Enzymes
15	PDB:3c8fA	0.251	0.602	4.377E-6	245	0.063	0.163	3c8fA.pdb.gz	Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
16	PDB:7qbuA	0.234	0.339	8.575E-5	418	0.047	0.072	7qbuA.pdb.gz	Crystallographic snapshots of a B 12 -dependent radical SAM methyltransferase.
17	PDB:5hr7A	0.245	0.407	1.727E-4	360	0.069	0.122	5hr7A.pdb.gz	Crystallographic capture of a radical S-adenosylmethionine enzyme in the act of modifying tRNA.
18	PDB:1wq5B	0.184	0.386	7.423E-4	261	0.047	0.115	1wq5B.pdb.gz
19	PDB:3ivtB	0.201	0.299	9.373E-4	400	0.064	0.102	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
20	PDB:6qk7C	0.256	0.348	1.888E-3	444	0.061	0.088	6qk7C.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5RKZ7	0.0	1100	636	0.847	0.847	MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus OX=10090 GN=Mocs1 PE=1 SV=2
2	Q9NZB8	0.0	1312	636	1.000	1.000	MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens OX=9606 GN=MOCS1 PE=1 SV=3
3	G5EAS9	1.59e-161	481	694	0.431	0.395	G5EAS9_EMENI Radical SAM core domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00947 PE=3 SV=1
4	Q39055	3.44e-149	438	390	0.321	0.523	CNX2_ARATH GTP 3',8-cyclase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX2 PE=1 SV=1
5	Q8IQF1	1.42e-138	417	565	0.314	0.354	MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster OX=7227 GN=Mocs1 PE=2 SV=1
6	P9WJS3	8.99e-69	229	359	0.186	0.329	MOAA1_MYCTU GTP 3',8-cyclase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaA1 PE=2 SV=1
7	P30745	5.02e-66	221	329	0.192	0.371	MOAA_ECOLI GTP 3',8-cyclase OS=Escherichia coli (strain K12) OX=83333 GN=moaA PE=1 SV=1
8	Q72EJ8	2.22e-60	207	341	0.182	0.340	Q72EJ8_DESVH GTP 3',8-cyclase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=moaA PE=1 SV=1
9	P9WJS1	1.06e-51	184	360	0.184	0.325	MOAA2_MYCTU GTP 3',8-cyclase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaA2 PE=1 SV=1
10	Q39056	3.27e-43	158	270	0.121	0.285	CNX3_ARATH Cyclic pyranopterin monophosphate synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX3 PE=1 SV=1
11	P0A738	5.72e-41	148	161	0.116	0.460	MOAC_ECOLI Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12) OX=83333 GN=moaC PE=1 SV=2
12	P9WJR9	1.63e-30	119	170	0.116	0.435	MOAC1_MYCTU Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaC1 PE=2 SV=1
13	Q382Y9	9.20e-06	51.2	775	0.069	0.057	Q382Y9_TRYB2 Molybdenum cofactor biosynthesis protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3750 PE=4 SV=1
14	Q726V2	4.19e-05	48.9	624	0.066	0.067	Q726V2_DESVH Radical SAM domain protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3004 PE=1 SV=1
15	P9WJ79	1.31e-04	47.0	391	0.068	0.110	MFTC_MYCTU Mycofactocin maturase MftC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mftC PE=1 SV=1
16	Q5RH95	1.82e-04	46.6	359	0.074	0.131	RSAD2_DANRE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Danio rerio OX=7955 GN=rsad2 PE=2 SV=1
17	G3XD10	0.001	44.3	387	0.057	0.093	G3XD10_PSEAE Heme d1 biosynthesis protein NirJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nirJ PE=4 SV=1
18	P95416	0.001	44.3	387	0.057	0.093	P95416_PSEAI Heme d1 biosynthesis radical SAM protein NirJ OS=Pseudomonas aeruginosa OX=287 GN=nirJ PE=4 SV=1
19	P11067	0.028	39.7	502	0.069	0.088	NIFB_AZOVI FeMo cofactor biosynthesis protein NifB OS=Azotobacter vinelandii OX=354 GN=nifB PE=3 SV=1
20	Q5AYI7	0.12	37.7	393	0.069	0.112	BIOB_EMENI Biotin synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bioB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13353 Fer4_12	0.00058	31.8	4Fe-4S single cluster domain
2	PF13394 Fer4_14	0.65	21.5	4Fe-4S single cluster domain
3	PF01967 MoaC	8.5e-47	170.1	MoaC family
4	PF06463 Mob_synth_C	1.4e-38	143.2	Molybdenum Cofactor Synthesis C
5	PF04055 Radical_SAM	3.9e-27	107.1	Radical SAM superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000008743

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000001273	0.998	Molybdopterin synthase catalytic subunit
2	9593.ENSGGOP00000009975	0.946	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
3	9593.ENSGGOP00000008796	0.914	Adenylyltransferase and sulfurtransferase MOCS3
4	9593.ENSGGOP00000021672	0.832	Adenylate cyclase 5
5	9593.ENSGGOP00000003828	0.828	Nudix hydrolase 2
6	9593.ENSGGOP00000002282	0.824	Adenylate cyclase 6
7	9593.ENSGGOP00000008544	0.822	Inosine triphosphate pyrophosphatase
8	9593.ENSGGOP00000015407	0.810	Adenylate cyclase 8 (brain)
9	9593.ENSGGOP00000004611	0.809	Adenylate cyclase 4
10	9593.ENSGGOP00000004004	0.807	Adenylate cyclase 3
11	9593.ENSGGOP00000010918	0.805	Adenylate cyclase 2 (brain)
12	9593.ENSGGOP00000014454	0.805	Adenylate cyclase 7
13	9593.ENSGGOP00000023723	0.805	Pyruvate kinase, liver and RBC
14	9593.ENSGGOP00000000971	0.804	Uncharacterized protein
15	9593.ENSGGOP00000005236	0.804	Ectonucleoside triphosphate diphosphohydrolase 1
16	9593.ENSGGOP00000009500	0.804	Guanylate cyclase 1, soluble, alpha 2
17	9593.ENSGGOP00000010968	0.804	Guanylate cyclase
18	9593.ENSGGOP00000023301	0.803	Sulfite oxidase
19	9593.ENSGGOP00000004924	0.802	Ectonucleoside triphosphate diphosphohydrolase 3
20	9593.ENSGGOP00000000660	0.801	Adenylate cyclase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016830	1.000	carbon-carbon lyase activity
GO:0061799	1.000	cyclic pyranopterin monophosphate synthase activity
GO:0051536	0.995	iron-sulfur cluster binding
GO:0061798	0.993	GTP 3',8'-cyclase activity
GO:0051539	0.973	4 iron, 4 sulfur cluster binding
GO:0005515	0.842	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046483	0.996	heterocycle metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0019637	0.995	organophosphate metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006796	0.993	phosphate-containing compound metabolic process
GO:0090407	0.993	organophosphate biosynthetic process
GO:1901362	0.992	organic cyclic compound biosynthetic process
GO:1901566	0.992	organonitrogen compound biosynthetic process
GO:0018130	0.992	heterocycle biosynthetic process
GO:0043170	0.948	macromolecule metabolic process
GO:0019538	0.919	protein metabolic process
GO:0032324	0.544	molybdopterin cofactor biosynthetic process
GO:0006777	0.359	Mo-molybdopterin cofactor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.994	cytosol
GO:0043226	0.852	organelle
GO:0043231	0.760	intracellular membrane-bounded organelle
GO:0070013	0.377	intracellular organelle lumen
GO:0005739	0.355	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.-.-	1.000	Carbon-carbon lyases.
RHEA:49580	1.000	(8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate = cyclic pyranopterin phosphate + diphosphate
EC:4.6.1.17	1.000	cyclic pyranopterin monophosphate synthase.
RHEA:49576	0.993	AH2 + GTP + S-adenosyl-L-methionine = (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate + 5'-deoxyadenosine + A + H(+) + L-methionine
EC:4.1.99.22	0.993	GTP 3',8-cyclase.

[back to server]