StarFunc result for job id Q9NZC2

User Input

>input (230 residues)
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPC
QRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADT
LRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLA
CIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZC2	1.000	1.000	2.045E-42	230	1.000	1.000	Q9NZC2.pdb.gz	TREM2_HUMAN Triggering receptor expressed on myeloid cells 2 OS=Homo sapiens OX=9606 GN=TREM2 PE=1 SV=1
2	AFDB:Q99NH8	0.553	0.560	2.253E-31	227	0.683	0.692	Q99NH8.pdb.gz	TREM2_MOUSE Triggering receptor expressed on myeloid cells 2 OS=Mus musculus OX=10090 GN=Trem2 PE=1 SV=1
3	AFDB:D3ZZ89	0.565	0.570	9.625E-27	228	0.552	0.557	D3ZZ89.pdb.gz	D3ZZ89_RAT Triggering receptor expressed on myeloid cells 2 OS=Rattus norvegicus OX=10116 GN=Trem2 PE=4 SV=2
4	PDB:6xdsA	0.442	0.215	1.355E-20	485	0.491	0.233	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
5	AFDB:Q08708	0.444	0.455	5.371E-14	224	0.213	0.219	Q08708.pdb.gz	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
6	AFDB:O95944	0.460	0.389	1.023E-13	276	0.222	0.185	O95944.pdb.gz	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
7	AFDB:Q9NP99	0.468	0.460	1.085E-13	234	0.239	0.235	Q9NP99.pdb.gz	TREM1_HUMAN Triggering receptor expressed on myeloid cells 1 OS=Homo sapiens OX=9606 GN=TREM1 PE=1 SV=1
8	AFDB:Q496F6	0.476	0.529	1.542E-13	205	0.239	0.268	Q496F6.pdb.gz	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
9	AFDB:Q8VCH2	0.450	0.467	2.323E-13	221	0.217	0.226	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
10	AFDB:Q3LRV9	0.469	0.414	4.426E-13	263	0.209	0.183	Q3LRV9.pdb.gz	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
11	AFDB:Q9JKE2	0.478	0.478	4.693E-13	230	0.209	0.209	Q9JKE2.pdb.gz	TREM1_MOUSE Triggering receptor expressed on myeloid cells 1 OS=Mus musculus OX=10090 GN=Trem1 PE=1 SV=1
12	PDB:6jxrm	0.397	0.370	1.717E-7	248	0.096	0.089	6jxrm.pdb.gz
13	PDB:1cd0A	0.356	0.678	7.426E-7	111	0.083	0.171	1cd0A.pdb.gz
14	PDB:1bd2D	0.411	0.492	7.874E-7	190	0.070	0.084	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
15	PDB:5ir3A	0.375	0.730	1.896E-6	111	0.083	0.171	5ir3A.pdb.gz
16	PDB:2cd0A	0.372	0.725	2.132E-6	111	0.083	0.171	2cd0A.pdb.gz
17	PDB:6dlfA	0.323	0.316	2.695E-6	236	0.087	0.085	6dlfA.pdb.gz
18	PDB:4y5xB	0.365	0.710	3.612E-6	111	0.091	0.189	4y5xB.pdb.gz
19	PDB:4aizA	0.356	0.710	4.565E-6	107	0.091	0.196	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
20	PDB:3zhlA	0.382	0.683	8.697E-6	121	0.104	0.198	3zhlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZC2	1.50e-170	470	230	1.000	1.000	TREM2_HUMAN Triggering receptor expressed on myeloid cells 2 OS=Homo sapiens OX=9606 GN=TREM2 PE=1 SV=1
2	Q99NH8	2.00e-100	293	227	0.678	0.687	TREM2_MOUSE Triggering receptor expressed on myeloid cells 2 OS=Mus musculus OX=10090 GN=Trem2 PE=1 SV=1
3	D3ZZ89	2.66e-83	250	248	0.526	0.488	D3ZZ89_RAT Triggering receptor expressed on myeloid cells 2 OS=Rattus norvegicus OX=10116 GN=Trem2 PE=4 SV=2
4	D4ABU7	7.63e-11	62.0	226	0.165	0.168	D4ABU7_RAT Triggering receptor expressed on myeloid cells 1 OS=Rattus norvegicus OX=10116 GN=Trem1 PE=4 SV=2
5	P01833	5.14e-08	55.1	764	0.178	0.054	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
6	Q9JKE2	2.22e-07	52.0	230	0.152	0.152	TREM1_MOUSE Triggering receptor expressed on myeloid cells 1 OS=Mus musculus OX=10090 GN=Trem1 PE=1 SV=1
7	O95944	3.36e-07	52.0	276	0.135	0.112	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
8	P15083	1.52e-06	50.8	769	0.152	0.046	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
9	Q496F6	5.87e-06	47.8	205	0.139	0.156	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
10	Q9UGN4	1.59e-05	47.0	299	0.139	0.107	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
11	Q08708	3.40e-05	45.8	224	0.170	0.174	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
12	Q7TSN2	3.83e-05	45.4	228	0.148	0.149	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
13	Q86YW5	6.13e-05	45.4	311	0.209	0.154	TRML1_HUMAN Trem-like transcript 1 protein OS=Homo sapiens OX=9606 GN=TREML1 PE=1 SV=2
14	A0A0K2S4Q6	8.88e-05	44.3	201	0.170	0.194	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
15	Q3LRV9	1.91e-04	43.9	263	0.178	0.156	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
16	Q8VCH2	3.46e-04	42.7	221	0.178	0.186	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
17	Q9NP99	3.88e-04	42.7	234	0.148	0.145	TREM1_HUMAN Triggering receptor expressed on myeloid cells 1 OS=Homo sapiens OX=9606 GN=TREM1 PE=1 SV=1
18	Q6SJQ0	6.97e-04	42.4	318	0.130	0.094	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
19	Q9JKE1	0.006	38.9	183	0.109	0.137	TREM3_MOUSE Triggering receptor expressed on myeloid cells 3 OS=Mus musculus OX=10090 GN=Trem3 PE=1 SV=1
20	Q8WWV6	0.010	38.9	532	0.135	0.058	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	3.8e+02	12.6	Immunoglobulin I-set domain
2	PF00047 ig	40	15.8	Immunoglobulin domain
3	PF13927 Ig_3	80	15.2	Immunoglobulin domain
4	PF07686 V-set	2.2e-06	39.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262629	0.999	TYRO protein tyrosine kinase-binding protein
2	9606.ENSP00000377061	0.996	Plexin-A1
3	9606.ENSP00000252486	0.995	Apolipoprotein E
4	9606.ENSP00000373620	0.975	60 kDa heat shock protein, mitochondrial
5	9606.ENSP00000244709	0.944	Triggering receptor expressed on myeloid cells 1
6	9606.ENSP00000364907	0.932	Tyrosine-protein kinase SYK
7	9606.ENSP00000315130	0.927	Clusterin
8	9606.ENSP00000286301	0.914	Macrophage colony-stimulating factor 1 receptor
9	9606.ENSP00000382941	0.900	Tyrosine-protein phosphatase non-receptor type substrate 1
10	9606.ENSP00000418767	0.850	Trem-like transcript 2 protein
11	9606.ENSP00000402855	0.847	Trem-like transcript 1 protein
12	9606.ENSP00000284981	0.833	Amyloid-beta A4 protein
13	9606.ENSP00000262262	0.829	Myeloid cell surface antigen CD33
14	9606.ENSP00000289902	0.804	High affinity immunoglobulin epsilon receptor subunit gamma
15	9606.ENSP00000305529	0.803	Signal-regulatory protein gamma
16	9606.ENSP00000482457	0.792	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
17	9606.ENSP00000363773	0.785	Complement C1q subcomponent subunit A
18	9606.ENSP00000326366	0.782	Presenilin-1
19	9606.ENSP00000313967	0.772	Complement C1q subcomponent subunit B
20	9606.ENSP00000363770	0.772	Complement C1q subcomponent subunit C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0097367	0.975	carbohydrate derivative binding
GO:0008289	0.897	lipid binding
GO:0044877	0.575	protein-containing complex binding
GO:0071814	0.482	protein-lipid complex binding
GO:0051861	0.452	glycolipid binding
GO:0071813	0.422	lipoprotein particle binding
GO:0008035	0.408	high-density lipoprotein particle binding
GO:0005543	0.398	phospholipid binding
GO:0098772	0.392	molecular function regulator activity
GO:0140677	0.364	molecular function activator activity
GO:0072341	0.360	modified amino acid binding
GO:0042277	0.330	peptide binding
GO:0030169	0.329	low-density lipoprotein particle binding
GO:0034185	0.316	apolipoprotein binding
GO:0097110	0.309	scaffold protein binding
GO:0001786	0.300	phosphatidylserine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048583	0.996	regulation of response to stimulus
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0048522	0.996	positive regulation of cellular process
GO:0065009	0.994	regulation of molecular function
GO:0031323	0.993	regulation of cellular metabolic process
GO:0009893	0.993	positive regulation of metabolic process
GO:1902531	0.993	regulation of intracellular signal transduction
GO:0080090	0.992	regulation of primary metabolic process
GO:0032879	0.990	regulation of localization
GO:0007165	0.985	signal transduction
GO:0048584	0.978	positive regulation of response to stimulus
GO:0051239	0.972	regulation of multicellular organismal process
GO:0048519	0.968	negative regulation of biological process
GO:0002685	0.968	regulation of leukocyte migration
GO:0050790	0.958	regulation of catalytic activity
GO:0044093	0.955	positive regulation of molecular function
GO:0043085	0.954	positive regulation of catalytic activity
GO:0051246	0.953	regulation of protein metabolic process
GO:0071310	0.952	cellular response to organic substance
GO:0006950	0.951	response to stress
GO:0048523	0.948	negative regulation of cellular process
GO:0002684	0.948	positive regulation of immune system process
GO:0010604	0.948	positive regulation of macromolecule metabolic process
GO:0051050	0.946	positive regulation of transport
GO:0051173	0.943	positive regulation of nitrogen compound metabolic process
GO:0006955	0.940	immune response
GO:1902533	0.937	positive regulation of intracellular signal transduction
GO:0032501	0.936	multicellular organismal process
GO:0051240	0.936	positive regulation of multicellular organismal process
GO:0031347	0.935	regulation of defense response
GO:0007166	0.934	cell surface receptor signaling pathway
GO:0051247	0.932	positive regulation of protein metabolic process
GO:0031325	0.928	positive regulation of cellular metabolic process
GO:0032103	0.925	positive regulation of response to external stimulus
GO:0019220	0.925	regulation of phosphate metabolic process
GO:0010468	0.922	regulation of gene expression
GO:0042325	0.922	regulation of phosphorylation
GO:0051347	0.921	positive regulation of transferase activity
GO:0050778	0.920	positive regulation of immune response
GO:0060627	0.918	regulation of vesicle-mediated transport
GO:0031349	0.918	positive regulation of defense response
GO:0045937	0.918	positive regulation of phosphate metabolic process
GO:0043549	0.910	regulation of kinase activity
GO:0001932	0.909	regulation of protein phosphorylation
GO:0031401	0.908	positive regulation of protein modification process
GO:0001934	0.903	positive regulation of protein phosphorylation
GO:0050727	0.894	regulation of inflammatory response
GO:0051128	0.893	regulation of cellular component organization
GO:0016192	0.890	vesicle-mediated transport
GO:0032880	0.869	regulation of protein localization
GO:0048856	0.847	anatomical structure development
GO:0048585	0.846	negative regulation of response to stimulus
GO:0040017	0.843	positive regulation of locomotion
GO:0030335	0.834	positive regulation of cell migration
GO:0033674	0.832	positive regulation of kinase activity
GO:0009968	0.831	negative regulation of signal transduction
GO:0043408	0.826	regulation of MAPK cascade
GO:0050764	0.806	regulation of phagocytosis
GO:0050730	0.805	regulation of peptidyl-tyrosine phosphorylation
GO:0043410	0.795	positive regulation of MAPK cascade
GO:0030100	0.794	regulation of endocytosis
GO:0002694	0.779	regulation of leukocyte activation
GO:0006909	0.771	phagocytosis
GO:0010628	0.730	positive regulation of gene expression
GO:0008152	0.713	metabolic process
GO:0030154	0.697	cell differentiation
GO:1905521	0.687	regulation of macrophage migration
GO:0065008	0.665	regulation of biological quality
GO:0051129	0.660	negative regulation of cellular component organization
GO:0060099	0.655	regulation of phagocytosis, engulfment
GO:0048468	0.525	cell development
GO:0044237	0.509	cellular metabolic process
GO:0002696	0.505	positive regulation of leukocyte activation
GO:0071840	0.485	cellular component organization or biogenesis
GO:0050793	0.471	regulation of developmental process
GO:0002687	0.448	positive regulation of leukocyte migration
GO:0016043	0.436	cellular component organization
GO:0009611	0.407	response to wounding
GO:0071704	0.378	organic substance metabolic process
GO:0001817	0.326	regulation of cytokine production
GO:0044238	0.318	primary metabolic process
GO:0006897	0.309	endocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098857	0.725	membrane microdomain
GO:0098590	0.646	plasma membrane region
GO:0045121	0.614	membrane raft
GO:0005737	0.559	cytoplasm
GO:0043231	0.546	intracellular membrane-bounded organelle
GO:0044853	0.417	plasma membrane raft

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]