StarFunc result for job id Q9NZC3

User Input

>input (331 residues)
MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLK
PRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTT
DGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAH
KATEALKKMYMEFPQLYNNSVVCSFLPEVIYKMRQTDRDVITALTHRPWSLSHTGDGKPR
YDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDFVSPAYLKKWSAKGIQVVGWT
VNTFDEKSYYESHLGSSYITDSMVEDCEPHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZC3	1.000	1.000	9.295E-71	331	1.000	1.000	Q9NZC3.pdb.gz	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
2	AFDB:Q9JL55	0.985	0.985	2.033E-64	331	0.879	0.879	Q9JL55.pdb.gz	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
3	AFDB:Q57YK9	0.746	0.742	4.058E-22	333	0.221	0.219	Q57YK9.pdb.gz	Q57YK9_TRYB2 GP-PDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.720 PE=4 SV=1
4	AFDB:P10908	0.612	0.806	1.595E-17	247	0.169	0.227	P10908.pdb.gz	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
5	AFDB:Q99LY2	0.557	0.559	1.427E-14	330	0.169	0.170	Q99LY2.pdb.gz	GDPD3_MOUSE Lysophospholipase D GDPD3 OS=Mus musculus OX=10090 GN=Gdpd3 PE=1 SV=2
6	AFDB:E7EY39	0.578	0.341	3.898E-14	584	0.196	0.111	E7EY39.pdb.gz
7	AFDB:Q9C907	0.582	0.498	4.136E-14	392	0.181	0.153	Q9C907.pdb.gz	GDPD5_ARATH Glycerophosphodiester phosphodiesterase GDPD5 OS=Arabidopsis thaliana OX=3702 GN=GDPD5 PE=2 SV=1
8	AFDB:A0A2R8QBH7	0.577	0.320	6.255E-14	621	0.187	0.100	A0A2R8QBH7.pdb.gz
9	AFDB:Q7L5L3	0.570	0.591	7.468E-14	318	0.160	0.167	Q7L5L3.pdb.gz	GDPD3_HUMAN Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 GN=GDPD3 PE=1 SV=3
10	AFDB:Q6P2T3	0.556	0.582	8.917E-14	315	0.166	0.175	Q6P2T3.pdb.gz	Q6P2T3_DANRE Glycerophosphodiester phosphodiesterase domain containing 1 like OS=Danio rerio OX=7955 GN=gdpd3 PE=2 SV=1
11	PDB:4girB	0.373	0.313	1.073E-4	411	0.139	0.112	4girB.pdb.gz	crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group P41212)
12	PDB:1dqxA	0.333	0.395	1.208E-4	267	0.091	0.112	1dqxA.pdb.gz	Anatomy of a proficient enzyme: the structure of orotidine 5'-monophosphate decarboxylase in the presence and absence of a potential transition state analog.
13	PDB:5dmnA	0.340	0.407	1.938E-4	263	0.112	0.141	5dmnA.pdb.gz
14	PDB:3cuzA	0.266	0.192	2.931E-4	529	0.112	0.070	3cuzA.pdb.gz	Atomic resolution structures of Escherichia coli and Bacillus anthracis malate synthase A: comparison with isoform G and implications for structure-based drug discovery
15	PDB:1telB	0.402	0.324	5.292E-4	428	0.112	0.086	1telB.pdb.gz
16	PDB:3ivtB	0.356	0.306	1.014E-3	400	0.115	0.095	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
17	PDB:1m3uA	0.342	0.407	1.141E-3	262	0.100	0.126	1m3uA.pdb.gz	Structure of E. coli Ketopantoate Hydroxymethyl Transferase Complexed with Ketopantoate and Mg(2+), Solved by Locating 160 Selenomethionine Sites.
18	PDB:4hnvB	0.354	0.140	1.141E-3	1033	0.112	0.036	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
19	PDB:1ec9D	0.254	0.203	1.211E-3	444	0.088	0.065	1ec9D.pdb.gz	Evolution of enzymatic activities in the enolase superfamily: crystallographic and mutagenesis studies of the reaction catalyzed by D-glucarate dehydratase from Escherichia coli.
20	PDB:1qtwA	0.289	0.323	1.284E-3	285	0.121	0.140	1qtwA.pdb.gz	Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JL55	0.0	614	331	0.879	0.879	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
2	Q9JL56	0.0	613	331	0.873	0.873	GDE1_MOUSE Glycerophosphodiester phosphodiesterase 1 OS=Mus musculus OX=10090 GN=Gde1 PE=1 SV=1
3	Q9NZC3	0.0	693	331	1.000	1.000	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
4	Q57YK9	5.56e-21	94.0	333	0.218	0.216	Q57YK9_TRYB2 GP-PDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.720 PE=4 SV=1
5	Q9ESM6	1.10e-13	73.9	539	0.145	0.089	GDPD2_MOUSE Glycerophosphoinositol inositolphosphodiesterase GDPD2 OS=Mus musculus OX=10090 GN=Gdpd2 PE=1 SV=1
6	P10908	2.82e-13	70.9	247	0.118	0.158	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
7	Q8N9F7	2.35e-09	60.1	314	0.193	0.204	GDPD1_HUMAN Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 GN=GDPD1 PE=1 SV=2
8	Q3KTM2	4.55e-09	59.7	599	0.088	0.048	GDPD5_CHICK Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Gallus gallus OX=9031 GN=GDPD5 PE=1 SV=1
9	Q8WTR4	1.80e-08	58.2	605	0.091	0.050	GDPD5_HUMAN Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=GDPD5 PE=1 SV=2
10	Q640M6	4.62e-08	56.6	607	0.103	0.056	GDPD5_MOUSE Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1
11	Q08959	3.18e-07	53.5	321	0.076	0.078	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
12	A0A2R8Q763	3.68e-07	53.9	579	0.069	0.040	A0A2R8Q763_DANRE Glycerophosphodiester phosphodiesterase domain-containing 5b OS=Danio rerio OX=7955 GN=gdpd5b PE=1 SV=1
13	E7FGJ8	3.95e-07	53.9	600	0.097	0.053	E7FGJ8_DANRE Glycerophosphodiester phosphodiesterase domain-containing 5a OS=Danio rerio OX=7955 GN=gdpd5a PE=3 SV=2
14	Q9CRY7	4.91e-07	52.8	314	0.190	0.201	GDPD1_MOUSE Lysophospholipase D GDPD1 OS=Mus musculus OX=10090 GN=Gdpd1 PE=1 SV=1
15	Q9C104	2.34e-06	51.6	1076	0.100	0.031	GDE1_SCHPO Glycerophosphocholine phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gde1 PE=1 SV=1
16	Q99LY2	5.56e-06	49.7	330	0.073	0.073	GDPD3_MOUSE Lysophospholipase D GDPD3 OS=Mus musculus OX=10090 GN=Gdpd3 PE=1 SV=2
17	Q9C907	8.82e-06	49.3	392	0.076	0.064	GDPD5_ARATH Glycerophosphodiester phosphodiesterase GDPD5 OS=Arabidopsis thaliana OX=3702 GN=GDPD5 PE=2 SV=1
18	P09394	1.11e-05	48.9	358	0.145	0.134	GLPQ_ECOLI Glycerophosphodiester phosphodiesterase, periplasmic OS=Escherichia coli (strain K12) OX=83333 GN=glpQ PE=1 SV=2
19	Q6P2T3	1.18e-05	48.5	315	0.076	0.079	Q6P2T3_DANRE Glycerophosphodiester phosphodiesterase domain containing 1 like OS=Danio rerio OX=7955 GN=gdpd3 PE=2 SV=1
20	Q02979	9.58e-05	46.6	1223	0.103	0.028	GDE1_YEAST Glycerophosphocholine phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03009 GDPD	5.2e-30	116.6	Glycerophosphoryl diester phosphodiesterase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261386

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356529	0.963	Regulator of G-protein signaling 16
2	9606.ENSP00000407112	0.860	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
3	9606.ENSP00000414558	0.847	Protein ABHD4
4	9606.ENSP00000235382	0.821	Regulator of G-protein signaling 2
5	9606.ENSP00000365725	0.820	Monoacylglycerol lipase ABHD12
6	9606.ENSP00000352833	0.747	Tyrosine-protein phosphatase non-receptor type 22
7	9606.ENSP00000364035	0.705	Fatty-acid amide hydrolase 2
8	9606.ENSP00000346255	0.687	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
9	9606.ENSP00000243167	0.665	Fatty-acid amide hydrolase 1
10	9606.ENSP00000265052	0.664	Monoglyceride lipase
11	9606.ENSP00000384363	0.638	Lysophospholipase D GDPD3
12	9606.ENSP00000420315	0.637	Monoacylglycerol lipase ABHD6
13	9606.ENSP00000304108	0.589	Protein FAM171B
14	9606.ENSP00000297056	0.583	Sn1-specific diacylglycerol lipase beta
15	9606.ENSP00000286733	0.572	N-acylethanolamine-hydrolyzing acid amidase
16	9606.ENSP00000339511	0.565	Huntingtin interacting protein M
17	9606.ENSP00000325425	0.536	Methionine adenosyltransferase 2 subunit beta
18	9606.ENSP00000257215	0.534	Sn1-specific diacylglycerol lipase alpha
19	9606.ENSP00000383719	0.532	Ubiquitin-conjugating enzyme E2 J2
20	9606.ENSP00000263655	0.516	CB1 cannabinoid receptor-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008889	1.000	glycerophosphodiester phosphodiesterase activity
GO:0005515	0.999	protein binding
GO:0047395	0.978	glycerophosphoinositol glycerophosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.995	cellular lipid metabolic process
GO:0006644	0.993	phospholipid metabolic process
GO:0046486	0.914	glycerolipid metabolic process
GO:0009056	0.747	catabolic process
GO:0044248	0.652	cellular catabolic process
GO:1901575	0.548	organic substance catabolic process
GO:0006650	0.547	glycerophospholipid metabolic process
GO:0006807	0.532	nitrogen compound metabolic process
GO:1901564	0.415	organonitrogen compound metabolic process
GO:0046503	0.408	glycerolipid catabolic process
GO:0046475	0.308	glycerophospholipid catabolic process
GO:0044281	0.304	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.975	plasma membrane
GO:0005737	0.352	cytoplasm
GO:0043227	0.325	membrane-bounded organelle
GO:0043229	0.319	intracellular organelle
GO:0043231	0.304	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12969	1.000	a sn-glycero-3-phosphodiester + H2O = an alcohol + H(+) + sn-glycerol 3-phosphate
EC:3.1.4.46	1.000	glycerophosphodiester phosphodiesterase.
RHEA:16501	0.978	H2O + sn-glycero-3-phospho-1D-myo-inositol = H(+) + myo-inositol + sn-glycerol 3-phosphate
EC:3.1.4.44	0.978	glycerophosphoinositol glycerophosphodiesterase.

[back to server]