StarFunc result for job id Q9NZC7

User Input

>input (414 residues)
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAM
TLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLV
QLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCN
ILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTV
YCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A411HBC7	0.751	0.751	2.424E-85	414	1.000	1.000	A0A411HBC7.pdb.gz	A0A411HBC7_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens OX=9606 GN=WWOX PE=2 SV=1
2	AFDB:Q803A8	0.729	0.733	2.412E-70	412	0.717	0.721	Q803A8.pdb.gz	WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio OX=7955 GN=wwox PE=2 SV=1
3	AFDB:Q9VLU5	0.725	0.734	4.961E-53	409	0.473	0.479	Q9VLU5.pdb.gz	WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster OX=7227 GN=Wwox PE=2 SV=1
4	AFDB:O80924	0.693	0.887	5.246E-34	321	0.278	0.358	O80924.pdb.gz	O80924_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g37540 PE=1 SV=1
5	AFDB:Q8BYK4	0.644	0.838	3.550E-33	316	0.300	0.392	Q8BYK4.pdb.gz	RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus OX=10090 GN=Rdh12 PE=2 SV=1
6	AFDB:A2RVM0	0.685	0.875	4.743E-33	322	0.285	0.366	A2RVM0.pdb.gz	TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC32 PE=2 SV=1
7	AFDB:Q96NR8	0.648	0.844	5.326E-33	316	0.297	0.389	Q96NR8.pdb.gz	RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens OX=9606 GN=RDH12 PE=1 SV=3
8	AFDB:A1Z729	0.638	0.796	7.541E-33	330	0.290	0.364	A1Z729.pdb.gz	A1Z729_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Rdh1 PE=1 SV=1
9	AFDB:Q8TC12	0.647	0.837	7.991E-33	318	0.292	0.381	Q8TC12.pdb.gz	RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11 PE=1 SV=2
10	AFDB:F4JNJ2	0.688	0.848	1.346E-32	333	0.275	0.342	F4JNJ2.pdb.gz	F4JNJ2_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g23420 PE=1 SV=1
11	PDB:7jk9A	0.621	0.804	4.194E-24	316	0.234	0.307	7jk9A.pdb.gz	Photocatalytic LPOR forms helical lattices that shape membranes for chlorophyll synthesis.
12	PDB:6t7mD	0.485	0.777	1.146E-14	249	0.138	0.229	6t7mD.pdb.gz
13	PDB:1n5dA	0.502	0.704	1.445E-14	288	0.164	0.236	1n5dA.pdb.gz	Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
14	PDB:1h5qA	0.498	0.765	1.720E-14	260	0.123	0.196	1h5qA.pdb.gz	The Crystallographic Structure of the Mannitol 2-Dehydrogenase Nadp+ Binary Complex from Agaricus Bisporus
15	PDB:4is3C	0.495	0.793	3.253E-14	250	0.111	0.184	4is3C.pdb.gz	Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
16	PDB:3o4rA	0.477	0.752	3.447E-14	254	0.126	0.205	3o4rA.pdb.gz	Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
17	PDB:3ndrA	0.466	0.760	4.880E-14	247	0.155	0.259	3ndrA.pdb.gz	Crystallization and preliminary X-ray analysis of SDR-type pyridoxal dehydrogenase from Mesorhizobium loti
18	PDB:2hrbA	0.468	0.687	5.171E-14	273	0.145	0.220	2hrbA.pdb.gz	Crystal Structure of human Carbonyl Reductase 3, complexed with NADP+
19	PDB:6emmA	0.469	0.707	6.152E-14	268	0.133	0.205	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
20	PDB:4fc6B	0.480	0.700	8.710E-14	276	0.114	0.170	4fc6B.pdb.gz	Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A411HBC7	0.0	871	414	1.000	1.000	A0A411HBC7_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens OX=9606 GN=WWOX PE=2 SV=1
2	Q803A8	0.0	627	412	0.717	0.721	WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio OX=7955 GN=wwox PE=2 SV=1
3	Q91WL8	0.0	820	414	0.937	0.937	WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus OX=10090 GN=Wwox PE=1 SV=1
4	Q9NZC7	0.0	871	414	1.000	1.000	WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens OX=9606 GN=WWOX PE=1 SV=1
5	Q9VLU5	8.30e-140	407	409	0.483	0.489	WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster OX=7227 GN=Wwox PE=2 SV=1
6	F5H3R5	1.48e-97	292	213	0.331	0.643	F5H3R5_HUMAN WW domain containing oxidoreductase OS=Homo sapiens OX=9606 GN=WWOX PE=1 SV=1
7	Q8BYK4	8.44e-66	214	316	0.314	0.411	RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus OX=10090 GN=Rdh12 PE=2 SV=1
8	A2RVM0	1.75e-65	214	322	0.287	0.370	TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TIC32 PE=2 SV=1
9	F4JNJ2	1.28e-62	206	333	0.290	0.360	F4JNJ2_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g23420 PE=1 SV=1
10	Q96NR8	2.91e-62	205	316	0.309	0.405	RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens OX=9606 GN=RDH12 PE=1 SV=3
11	Q9LDY7	3.90e-60	199	317	0.268	0.350	Q9LDY7_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g11410 PE=1 SV=1
12	Q960C7	4.17e-60	200	330	0.297	0.373	Q960C7_DROME SD07613p OS=Drosophila melanogaster OX=7227 GN=Rdh1 PE=2 SV=1
13	A1Z729	6.11e-59	197	330	0.300	0.376	A1Z729_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Rdh1 PE=1 SV=1
14	O80924	3.80e-58	194	321	0.287	0.371	O80924_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g37540 PE=1 SV=1
15	Q7JUS1	5.12e-58	194	331	0.302	0.378	Q7JUS1_DROME AT09608p OS=Drosophila melanogaster OX=7227 GN=CG30491;CG30495 PE=1 SV=1
16	Q8MZG9	1.27e-56	191	325	0.290	0.369	Q8MZG9_DROME LP06328p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2070 PE=2 SV=1
17	Q17QW3	2.18e-56	190	336	0.302	0.372	RDH14_BOVIN Retinol dehydrogenase 14 OS=Bos taurus OX=9913 GN=RDH14 PE=2 SV=1
18	Q8TC12	2.25e-56	190	318	0.295	0.384	RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11 PE=1 SV=2
19	Q53RX3	2.32e-56	190	336	0.287	0.354	Q53RX3_HUMAN Retinol dehydrogenase 14 (All-trans and 9-cis), isoform CRA_a OS=Homo sapiens OX=9606 GN=RDH14 PE=2 SV=1
20	Q9HBH5	2.32e-56	190	336	0.287	0.354	RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	1.3e-22	91.7	short chain dehydrogenase
2	PF13561 adh_short_C2	6.8e-13	60.3	Enoyl-(Acyl carrier protein) reductase
3	PF08659 KR	0.00079	30.9	KR domain
4	PF00397 WW	6.2e-14	63.1	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457230

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
2	9606.ENSP00000342235	0.997	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000201031	0.992	Transcription factor AP-2 gamma
4	9606.ENSP00000401853	0.988	Hyaluronidase-2
5	9606.ENSP00000367545	0.985	Tumor protein p73
6	9606.ENSP00000467579	0.983	WW domain-binding protein 2
7	9606.ENSP00000005340	0.946	Segment polarity protein dishevelled homolog DVL-2
8	9606.ENSP00000478927	0.909	Transcriptional coactivator YAP1
9	9606.ENSP00000360266	0.882	Transcription factor AP-1
10	9606.ENSP00000371341	0.881	Activated CDC42 kinase 1
11	9606.ENSP00000356042	0.874	Ezrin
12	9606.ENSP00000417480	0.860	Bis(5'-adenosyl)-triphosphatase
13	9606.ENSP00000278616	0.838	Serine-protein kinase ATM
14	9606.ENSP00000378974	0.830	Mitogen-activated protein kinase 8
15	9606.ENSP00000361027	0.817	Angiomotin
16	9606.ENSP00000354958	0.773	Protein FAM189B
17	9606.ENSP00000341551	0.766	Mothers against decapentaplegic homolog 4
18	9606.ENSP00000285279	0.761	Vesicular, overexpressed in cancer, prosurvival protein 1
19	9606.ENSP00000352424	0.760	TGFB1-induced anti-apoptotic factor 1
20	9606.ENSP00000459533	0.760	Lipopolysaccharide-induced tumor necrosis factor-alpha factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0003824	0.997	catalytic activity
GO:0016491	0.833	oxidoreductase activity
GO:0042802	0.792	identical protein binding
GO:0016614	0.622	oxidoreductase activity, acting on CH-OH group of donors
GO:0016616	0.568	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0048583	0.984	regulation of response to stimulus
GO:0023051	0.982	regulation of signaling
GO:0010646	0.982	regulation of cell communication
GO:0009987	0.966	cellular process
GO:0048519	0.922	negative regulation of biological process
GO:0009966	0.912	regulation of signal transduction
GO:0048523	0.849	negative regulation of cellular process
GO:0071495	0.685	cellular response to endogenous stimulus
GO:0019222	0.684	regulation of metabolic process
GO:0071559	0.677	response to transforming growth factor beta
GO:0048518	0.628	positive regulation of biological process
GO:0031323	0.603	regulation of cellular metabolic process
GO:0080090	0.568	regulation of primary metabolic process
GO:0071363	0.555	cellular response to growth factor stimulus
GO:0048522	0.551	positive regulation of cellular process
GO:0060255	0.547	regulation of macromolecule metabolic process
GO:0051171	0.546	regulation of nitrogen compound metabolic process
GO:0008152	0.491	metabolic process
GO:0051716	0.467	cellular response to stimulus
GO:0071704	0.435	organic substance metabolic process
GO:0044237	0.417	cellular metabolic process
GO:0044238	0.407	primary metabolic process
GO:0007154	0.400	cell communication
GO:0009893	0.399	positive regulation of metabolic process
GO:0010468	0.395	regulation of gene expression
GO:0010604	0.394	positive regulation of macromolecule metabolic process
GO:0051173	0.379	positive regulation of nitrogen compound metabolic process
GO:0019219	0.378	regulation of nucleobase-containing compound metabolic process
GO:0023052	0.375	signaling
GO:0031326	0.374	regulation of cellular biosynthetic process
GO:0051252	0.374	regulation of RNA metabolic process
GO:0010556	0.373	regulation of macromolecule biosynthetic process
GO:0031325	0.373	positive regulation of cellular metabolic process
GO:0007165	0.373	signal transduction
GO:0006355	0.353	regulation of DNA-templated transcription
GO:0032501	0.333	multicellular organismal process
GO:0032502	0.321	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.996	cytosol
GO:0012505	0.978	endomembrane system
GO:0016020	0.949	membrane
GO:0032991	0.864	protein-containing complex
GO:0005794	0.789	Golgi apparatus
GO:0005886	0.709	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.833	Oxidoreductases.
EC:1.1.-.-	0.622	Acting on the CH-OH group of donors.
EC:1.1.1.-	0.568	With NAD(+) or NADP(+) as acceptor.

[back to server]