StarFunc result for job id Q9NZC9

User Input

>input (954 residues)
MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQNFPRE
SCKPVSHGVIFKQQNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALT
GISPPLAQSPPEVPKQQLLSYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHS
SGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGK
CVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFSMNDYSALMKAAQSLPTVNLQ
PLEWAYGSSESPSTSSEGQAGLPSAPSLSFVKGRCMLISRAYFEADISYSQDLIALFKQM
DSRRYDVKTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTTLTLAFASQLKKTSLSLTPDV
PEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLLLADDMGLGKTIQAICIAAFYRKEWP
LLVVVPSSVRFTWEQAFLRWLPSLSPDCINVVVTGKDRLTAGLINIVSFDLLSKLEKQLK
TPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPT
FFPQFHAFGLRYCDAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRK
IVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALILFFNRTAEAKIPSVIEYILDL
LESGREKFLVFAHHKVVLDAITQELERKHVQHIRIDGSTSSAEREDLCQQFQLSERHAVA
VLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADD
YLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQKSFEKEGSDMELL
EAAESFDPGSASGTSGSSSQNMGDTLDESSLTASPQKKRRFEFFDNWDSFTSPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H7BYI2	0.601	0.718	0.000	796	0.831	0.996	H7BYI2.pdb.gz	H7BYI2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1
2	AFDB:Q9NZC9	1.000	1.000	0.000	954	1.000	1.000	Q9NZC9.pdb.gz	SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1
3	AFDB:F4KBP5	0.392	0.174	1.263E-29	2223	0.182	0.078	F4KBP5.pdb.gz	CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana OX=3702 GN=CHR4 PE=2 SV=1
4	PDB:7oo3b	0.390	0.666	1.938E-24	534	0.118	0.212	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
5	AFDB:Q9GQN5	0.375	0.280	5.199E-24	1311	0.187	0.136	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
6	PDB:6jylK	0.373	0.670	5.107E-23	504	0.122	0.230	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
7	PDB:6tdaS	0.381	0.459	1.547E-22	783	0.115	0.140	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:6g0lM	0.365	0.405	3.667E-21	855	0.133	0.149	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
9	PDB:6gejM	0.345	0.471	5.306E-21	688	0.128	0.177	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
10	PDB:7epuB	0.243	0.292	8.532E-21	748	0.123	0.156	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
11	PDB:6uxwA	0.373	0.451	1.054E-20	778	0.122	0.149	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
12	PDB:6g0lW	0.370	0.400	1.786E-20	878	0.125	0.136	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	AFDB:Q9VDY1	0.401	0.241	2.459E-19	1638	0.143	0.083	Q9VDY1.pdb.gz	INO80_DROME Chromatin-remodeling ATPase INO80 OS=Drosophila melanogaster OX=7227 GN=Ino80 PE=1 SV=2
14	PDB:5vvrM	0.369	0.659	2.634E-19	503	0.104	0.197	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
15	PDB:6kw3Y	0.368	0.606	1.502E-18	548	0.118	0.206	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	AFDB:Q08562	0.360	0.221	5.247E-18	1619	0.198	0.117	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
17	AFDB:Q9SQV1	0.290	0.257	1.250E-13	1088	0.136	0.119	Q9SQV1.pdb.gz	RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana OX=3702 GN=RH40 PE=2 SV=1
18	AFDB:Q9FNM7	0.270	0.300	1.052E-11	850	0.119	0.134	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
19	AFDB:Q54DM3	0.263	0.205	1.395E-10	1259	0.123	0.093	Q54DM3.pdb.gz	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
20	AFDB:Q9I920	0.291	0.240	3.803E-10	1183	0.123	0.099	Q9I920.pdb.gz	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2ZFP3	0.0	850	807	0.443	0.524	SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio OX=7955 GN=smarcal1 PE=2 SV=1
2	H7BYI2	0.0	1627	796	0.834	1.000	H7BYI2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1
3	H7C051	0.0	659	325	0.340	0.997	H7C051_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=8
4	Q8BJL0	0.0	1283	910	0.716	0.751	SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus OX=10090 GN=Smarcal1 PE=1 SV=1
5	Q9NZC9	0.0	1969	954	1.000	1.000	SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1
6	Q9VMX6	1.33e-123	395	755	0.230	0.290	SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Marcal1 PE=1 SV=2
7	Q5FWF4	1.07e-110	369	1079	0.212	0.187	ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens OX=9606 GN=ZRANB3 PE=1 SV=2
8	Q385P2	5.26e-88	304	968	0.215	0.212	Q385P2_TRYB2 SNF2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2930 PE=4 SV=1
9	Q384V0	1.82e-50	195	952	0.147	0.147	Q384V0_TRYB2 SNF2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5060 PE=4 SV=1
10	Q9VF02	6.11e-35	147	1923	0.165	0.082	Q9VF02_DROME Helicase 89B, isoform B OS=Drosophila melanogaster OX=7227 GN=Hel89B PE=1 SV=3
11	Q54Q16	5.15e-33	141	1917	0.128	0.064	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
12	O14981	5.20e-33	141	1849	0.171	0.088	BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2
13	Q2M1V9	5.20e-33	141	1849	0.171	0.088	Q2M1V9_HUMAN BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=1
14	O60264	2.39e-32	138	1052	0.132	0.120	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
15	Q91ZW3	5.51e-32	137	1051	0.131	0.119	SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus OX=10090 GN=Smarca5 PE=1 SV=1
16	Q60EX7	1.67e-31	135	1128	0.134	0.113	CHR19_ORYSJ Probable ATP-dependent DNA helicase CHR719 OS=Oryza sativa subsp. japonica OX=39947 GN=CHR719 PE=1 SV=1
17	F4K128	2.30e-31	135	1064	0.132	0.118	CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana OX=3702 GN=CHR23 PE=2 SV=1
18	Q22516	2.44e-31	135	1787	0.136	0.073	CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans OX=6239 GN=chd-3 PE=2 SV=2
19	F4J9M5	4.94e-31	134	1102	0.161	0.140	CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana OX=3702 GN=CHR12 PE=2 SV=1
20	Q1LYP4	1.22e-30	133	1929	0.127	0.063	Q1LYP4_DANRE DNA helicase OS=Danio rerio OX=7955 GN=im:7143343 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16203 ERCC3_RAD25_C	18	16.1	ERCC3/RAD25/XPB C-terminal helicase
2	PF07652 Flavi_DEAD	15	17.0	Flavivirus DEAD domain
3	PF07443 HARP	3e-48	172.4	HepA-related protein (HARP)
4	PF00271 Helicase_C	3e-11	55.0	Helicase conserved C-terminal domain
5	PF04851 ResIII	0.22	23.0	Type III restriction enzyme, res subunit
6	PF00176 SNF2-rel_dom	3.3e-23	93.7	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363017	0.999	Replication protein A 32 kDa subunit
2	9606.ENSP00000254719	0.994	Replication protein A 70 kDa DNA-binding subunit
3	9606.ENSP00000343741	0.954	Serine/threonine-protein kinase ATR
4	9606.ENSP00000323099	0.950	ATR-interacting protein
5	9606.ENSP00000260810	0.945	DNA topoisomerase 2-binding protein 1
6	9606.ENSP00000426191	0.940	Cell cycle checkpoint protein RAD17
7	9606.ENSP00000298139	0.939	Werner syndrome ATP-dependent helicase
8	9606.ENSP00000311360	0.939	Cell cycle checkpoint control protein RAD9A
9	9606.ENSP00000258774	0.932	Checkpoint protein HUS1
10	9606.ENSP00000055077	0.925	Replication factor C subunit 2
11	9606.ENSP00000408295	0.919	Replication factor C subunit 5
12	9606.ENSP00000376272	0.918	Replication factor C subunit 4
13	9606.ENSP00000371469	0.912	Cell cycle checkpoint protein RAD1
14	9606.ENSP00000369411	0.910	Replication factor C subunit 3
15	9606.ENSP00000224950	0.874	CST complex subunit STN1
16	9606.ENSP00000267430	0.817	Fanconi anemia group M protein
17	9606.ENSP00000307853	0.793	Crossover junction endonuclease MUS81
18	9606.ENSP00000416739	0.763	ATP-dependent DNA helicase Q1
19	9606.ENSP00000307208	0.756	Nucleosome-remodeling factor subunit BPTF
20	9606.ENSP00000369335	0.751	F-box DNA helicase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	1.000	ATP-dependent activity
GO:0005515	1.000	protein binding
GO:1990814	0.997	DNA/DNA annealing activity
GO:0003824	0.815	catalytic activity
GO:0036310	0.783	ATP-dependent DNA/DNA annealing activity
GO:0140640	0.600	catalytic activity, acting on a nucleic acid
GO:0140097	0.384	catalytic activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0050789	0.992	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0019222	0.980	regulation of metabolic process
GO:0044260	0.979	cellular macromolecule metabolic process
GO:0050794	0.978	regulation of cellular process
GO:0006139	0.955	nucleobase-containing compound metabolic process
GO:0006260	0.953	DNA replication
GO:0051716	0.950	cellular response to stimulus
GO:0006950	0.947	response to stress
GO:0006281	0.937	DNA repair
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0080090	0.932	regulation of primary metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0031323	0.907	regulation of cellular metabolic process
GO:0016043	0.892	cellular component organization
GO:0006261	0.892	DNA-templated DNA replication
GO:0019219	0.879	regulation of nucleobase-containing compound metabolic process
GO:0045005	0.849	DNA-templated DNA replication maintenance of fidelity
GO:0006996	0.831	organelle organization
GO:0006302	0.759	double-strand break repair
GO:0031326	0.725	regulation of cellular biosynthetic process
GO:0010556	0.724	regulation of macromolecule biosynthetic process
GO:0031297	0.690	replication fork processing
GO:0010468	0.634	regulation of gene expression
GO:0051252	0.609	regulation of RNA metabolic process
GO:1903506	0.586	regulation of nucleic acid-templated transcription
GO:0006355	0.506	regulation of DNA-templated transcription
GO:0000723	0.391	telomere maintenance
GO:0048519	0.322	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005694	0.995	chromosome
GO:0140513	0.946	nuclear protein-containing complex
GO:0005657	0.889	replication fork
GO:0000228	0.877	nuclear chromosome
GO:0032993	0.857	protein-DNA complex
GO:0043596	0.811	nuclear replication fork
GO:0090734	0.809	site of DNA damage
GO:0043601	0.762	nuclear replisome
GO:0035861	0.629	site of double-strand break
GO:0005662	0.552	DNA replication factor A complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]