StarFunc result for job id Q9NZF1

User Input

>input (115 residues)
MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNE
CCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JI48	0.855	0.877	8.372E-15	112	0.817	0.839	Q9JI48.pdb.gz	PLAC8_MOUSE Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1
2	AFDB:Q96EJ4	0.793	0.793	1.489E-14	115	0.957	0.957	Q96EJ4.pdb.gz	Q96EJ4_HUMAN PLAC8 protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	AFDB:Q9BYD5	0.699	0.717	1.748E-6	112	0.383	0.393	Q9BYD5.pdb.gz	CNFN_HUMAN Cornifelin OS=Homo sapiens OX=9606 GN=CNFN PE=1 SV=2
4	AFDB:E7F147	0.731	0.677	3.638E-5	125	0.330	0.304	E7F147.pdb.gz	E7F147_DANRE Plac8 onzin-related protein 1 OS=Danio rerio OX=7955 GN=gb:eh433777 PE=1 SV=1
5	AFDB:Q3EBY6	0.662	0.201	1.661E-3	416	0.243	0.067	Q3EBY6.pdb.gz	MCAC2_ARATH Protein MID1-COMPLEMENTING ACTIVITY 2 OS=Arabidopsis thaliana OX=3702 GN=MCA2 PE=2 SV=1
6	AFDB:Q9LQU4	0.673	0.522	1.750E-3	152	0.287	0.217	Q9LQU4.pdb.gz	PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=PCR2 PE=1 SV=1
7	AFDB:Q9LQU2	0.657	0.516	2.803E-3	151	0.304	0.232	Q9LQU2.pdb.gz	PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana OX=3702 GN=PCR1 PE=1 SV=1
8	AFDB:B0G108	0.662	0.696	4.260E-3	109	0.226	0.239	B0G108.pdb.gz	B0G108_DICDI DUF614 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274237 PE=4 SV=1
9	AFDB:B6TYV8	0.664	0.438	4.730E-3	181	0.287	0.182	B6TYV8.pdb.gz	CNR2_MAIZE Cell number regulator 2 OS=Zea mays OX=4577 GN=CNR2 PE=2 SV=1
10	AFDB:Q9SX24	0.651	0.484	8.864E-3	160	0.261	0.188	Q9SX24.pdb.gz	PCR11_ARATH Protein PLANT CADMIUM RESISTANCE 11 OS=Arabidopsis thaliana OX=3702 GN=PCR11 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZF1	2.38e-81	235	115	1.000	1.000	PLAC8_HUMAN Placenta-specific gene 8 protein OS=Homo sapiens OX=9606 GN=PLAC8 PE=2 SV=1
2	Q96EJ4	2.09e-76	223	115	0.957	0.957	Q96EJ4_HUMAN PLAC8 protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	Q9JI48	4.20e-64	191	112	0.817	0.839	PLAC8_MOUSE Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1
4	Q9BYD5	3.58e-17	72.8	112	0.357	0.366	CNFN_HUMAN Cornifelin OS=Homo sapiens OX=9606 GN=CNFN PE=1 SV=2
5	E7F147	7.33e-15	67.4	125	0.374	0.344	E7F147_DANRE Plac8 onzin-related protein 1 OS=Danio rerio OX=7955 GN=gb:eh433777 PE=1 SV=1
6	Q9LQU4	1.61e-07	48.9	152	0.304	0.230	PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=PCR2 PE=1 SV=1
7	Q9LQU2	1.31e-06	46.6	151	0.296	0.225	PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana OX=3702 GN=PCR1 PE=1 SV=1
8	Q8L7E9	0.010	36.6	421	0.270	0.074	MCAC1_ARATH Protein MID1-COMPLEMENTING ACTIVITY 1 OS=Arabidopsis thaliana OX=3702 GN=MCA1 PE=1 SV=1
9	Q3EBY6	0.013	36.2	416	0.243	0.067	MCAC2_ARATH Protein MID1-COMPLEMENTING ACTIVITY 2 OS=Arabidopsis thaliana OX=3702 GN=MCA2 PE=2 SV=1
10	B0G108	0.014	35.0	109	0.270	0.284	B0G108_DICDI DUF614 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274237 PE=4 SV=1
11	B6TZ45	0.016	35.4	191	0.261	0.157	CNR1_MAIZE Cell number regulator 1 OS=Zea mays OX=4577 GN=CNR1 PE=2 SV=1
12	Q9M815	1.5	30.0	190	0.235	0.142	PCR8_ARATH Protein PLANT CADMIUM RESISTANCE 8 OS=Arabidopsis thaliana OX=3702 GN=PCR8 PE=1 SV=2
13	Q6FIU8	6.4	28.5	4880	0.113	0.003	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04749 PLAC8	2.1e-11	56.0	PLAC8 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399700

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417510	0.848	SPT20 homolog, SAGA complex component
2	9606.ENSP00000305852	0.763	Transmembrane 4 L6 family member 4
3	9606.ENSP00000229281	0.758	Protein C10
4	9606.ENSP00000303550	0.733	Cytokine-like protein 1
5	9606.ENSP00000345494	0.712	Phospholipid scramblase 1
6	9606.ENSP00000462435	0.664	Tubulin polymerization-promoting protein family member 3
7	9606.ENSP00000359783	0.626	Interferon-induced protein 44
8	9606.ENSP00000464087	0.606	E3 ubiquitin-protein ligase RNF213
9	9606.ENSP00000405574	0.603	F-box-like/WD repeat-containing protein TBL1XR1
10	9606.ENSP00000333657	0.578	Interferon-induced GTP-binding protein Mx2
11	9606.ENSP00000162391	0.520	Forkhead box protein J2
12	9606.ENSP00000215794	0.510	Ubl carboxyl-terminal hydrolase 18
13	9606.ENSP00000414922	0.510	Putative ubiquitin carboxyl-terminal hydrolase 41
14	9606.ENSP00000318195	0.506	Nucleolin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.580	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0009987	0.981	cellular process
GO:0008152	0.967	metabolic process
GO:0032502	0.959	developmental process
GO:0048519	0.954	negative regulation of biological process
GO:0006950	0.938	response to stress
GO:0048523	0.908	negative regulation of cellular process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0048518	0.903	positive regulation of biological process
GO:0051707	0.900	response to other organism
GO:0080090	0.894	regulation of primary metabolic process
GO:0051171	0.892	regulation of nitrogen compound metabolic process
GO:0051252	0.883	regulation of RNA metabolic process
GO:0048522	0.882	positive regulation of cellular process
GO:0009893	0.880	positive regulation of metabolic process
GO:0010468	0.879	regulation of gene expression
GO:0071704	0.873	organic substance metabolic process
GO:0010604	0.849	positive regulation of macromolecule metabolic process
GO:0044237	0.821	cellular metabolic process
GO:0044238	0.781	primary metabolic process
GO:0031325	0.776	positive regulation of cellular metabolic process
GO:0010556	0.757	regulation of macromolecule biosynthetic process
GO:0031326	0.755	regulation of cellular biosynthetic process
GO:0051173	0.754	positive regulation of nitrogen compound metabolic process
GO:0006355	0.750	regulation of DNA-templated transcription
GO:0098542	0.726	defense response to other organism
GO:0006807	0.649	nitrogen compound metabolic process
GO:0043170	0.607	macromolecule metabolic process
GO:0045893	0.451	positive regulation of DNA-templated transcription
GO:0032501	0.430	multicellular organismal process
GO:1901360	0.400	organic cyclic compound metabolic process
GO:0051239	0.397	regulation of multicellular organismal process
GO:0046483	0.391	heterocycle metabolic process
GO:0006725	0.391	cellular aromatic compound metabolic process
GO:0006357	0.390	regulation of transcription by RNA polymerase II
GO:0042127	0.362	regulation of cell population proliferation
GO:0044249	0.358	cellular biosynthetic process
GO:1901576	0.345	organic substance biosynthetic process
GO:0010941	0.341	regulation of cell death
GO:0009617	0.337	response to bacterium
GO:1901362	0.336	organic cyclic compound biosynthetic process
GO:0051241	0.334	negative regulation of multicellular organismal process
GO:0060548	0.306	negative regulation of cell death
GO:0006139	0.306	nucleobase-containing compound metabolic process
GO:0045944	0.301	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0070013	0.998	intracellular organelle lumen
GO:0031982	0.990	vesicle
GO:0005634	0.982	nucleus
GO:0005576	0.960	extracellular region
GO:0012505	0.929	endomembrane system
GO:0031981	0.759	nuclear lumen
GO:0031410	0.757	cytoplasmic vesicle
GO:0005773	0.716	vacuole
GO:0000323	0.705	lytic vacuole
GO:0005764	0.695	lysosome
GO:0099503	0.688	secretory vesicle
GO:0030141	0.663	secretory granule
GO:0005766	0.646	primary lysosome
GO:0031983	0.627	vesicle lumen
GO:0005775	0.627	vacuolar lumen
GO:0042582	0.627	azurophil granule
GO:0005615	0.537	extracellular space
GO:0005654	0.537	nucleoplasm
GO:0035578	0.416	azurophil granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]