StarFunc result for job id Q9NZH0

User Input

>input (403 residues)
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET
ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW
LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA
FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS
GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QYX2	0.750	0.750	3.122E-48	403	1.000	1.000	A0A024QYX2.pdb.gz
2	AFDB:Q923Z0	0.786	0.774	4.633E-44	410	0.868	0.854	Q923Z0.pdb.gz	GPC5B_MOUSE G-protein coupled receptor family C group 5 member B OS=Mus musculus OX=10090 GN=Gprc5b PE=1 SV=1
3	AFDB:A0A0C4DFY5	0.650	0.545	9.671E-24	486	0.392	0.325	A0A0C4DFY5.pdb.gz	A0A0C4DFY5_HUMAN G protein-coupled receptor class C group 5 member C OS=Homo sapiens OX=9606 GN=GPRC5C PE=1 SV=1
4	AFDB:Q8K3J9	0.654	0.600	1.915E-23	440	0.357	0.327	Q8K3J9.pdb.gz	GPC5C_MOUSE G-protein coupled receptor family C group 5 member C OS=Mus musculus OX=10090 GN=Gprc5c PE=1 SV=2
5	AFDB:Q8BHL4	0.620	0.700	4.743E-19	356	0.298	0.337	Q8BHL4.pdb.gz	RAI3_MOUSE Retinoic acid-induced protein 3 OS=Mus musculus OX=10090 GN=Gprc5a PE=1 SV=1
6	AFDB:Q8NFJ5	0.646	0.725	6.395E-19	357	0.295	0.333	Q8NFJ5.pdb.gz	RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens OX=9606 GN=GPRC5A PE=1 SV=2
7	AFDB:Q9JIL6	0.612	0.714	2.408E-17	344	0.275	0.323	Q9JIL6.pdb.gz	GPC5D_MOUSE G-protein coupled receptor family C group 5 member D OS=Mus musculus OX=10090 GN=Gprc5d PE=2 SV=2
8	AFDB:Q9NZD1	0.626	0.726	3.536E-17	345	0.256	0.299	Q9NZD1.pdb.gz	GPC5D_HUMAN G-protein coupled receptor family C group 5 member D OS=Homo sapiens OX=9606 GN=GPRC5D PE=1 SV=1
9	AFDB:P91685	0.535	0.231	7.132E-10	976	0.159	0.066	P91685.pdb.gz	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2
10	AFDB:A1Z7F5	0.513	0.173	1.538E-9	1248	0.171	0.055	A1Z7F5.pdb.gz	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
11	PDB:7e9gR	0.493	0.270	2.819E-7	769	0.159	0.083	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
12	PDB:7epaA	0.486	0.261	2.008E-6	782	0.136	0.070	7epaA.pdb.gz
13	PDB:7e9hR	0.514	0.282	7.229E-6	766	0.134	0.070	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
14	PDB:7epcA	0.475	0.256	1.064E-4	782	0.119	0.061	7epcA.pdb.gz
15	PDB:6ffhA	0.484	0.471	1.159E-4	414	0.124	0.121	6ffhA.pdb.gz	Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures.
16	PDB:7c7sA	0.468	0.285	1.631E-4	685	0.079	0.047	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
17	PDB:7wihA	0.435	0.251	3.517E-4	741	0.127	0.069	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
18	PDB:7td3R	0.447	0.590	8.260E-4	292	0.079	0.110	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
19	PDB:4k5yC	0.374	0.538	9.388E-4	248	0.067	0.109	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
20	PDB:7yu4A	0.425	0.604	1.067E-3	266	0.072	0.109	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q923Z0	0.0	652	410	0.873	0.859	GPC5B_MOUSE G-protein coupled receptor family C group 5 member B OS=Mus musculus OX=10090 GN=Gprc5b PE=1 SV=1
2	Q9NZH0	0.0	822	403	1.000	1.000	GPC5B_HUMAN G-protein coupled receptor family C group 5 member B OS=Homo sapiens OX=9606 GN=GPRC5B PE=2 SV=2
3	Q8K3J9	1.18e-92	287	440	0.414	0.380	GPC5C_MOUSE G-protein coupled receptor family C group 5 member C OS=Mus musculus OX=10090 GN=Gprc5c PE=1 SV=2
4	Q9NQ84	1.18e-80	256	441	0.385	0.351	GPC5C_HUMAN G-protein coupled receptor family C group 5 member C OS=Homo sapiens OX=9606 GN=GPRC5C PE=1 SV=2
5	A0A0C4DFY5	4.34e-80	256	486	0.385	0.319	A0A0C4DFY5_HUMAN G protein-coupled receptor class C group 5 member C OS=Homo sapiens OX=9606 GN=GPRC5C PE=1 SV=1
6	Q8BHL4	5.40e-57	192	356	0.310	0.351	RAI3_MOUSE Retinoic acid-induced protein 3 OS=Mus musculus OX=10090 GN=Gprc5a PE=1 SV=1
7	Q8NFJ5	5.38e-56	190	357	0.290	0.328	RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens OX=9606 GN=GPRC5A PE=1 SV=2
8	A0A3B3ITN8	7.26e-56	189	339	0.290	0.345	A0A3B3ITN8_HUMAN G protein-coupled receptor class C group 5 member A OS=Homo sapiens OX=9606 GN=GPRC5A PE=1 SV=1
9	F5GWG3	1.20e-52	178	273	0.256	0.377	F5GWG3_HUMAN G protein-coupled receptor class C group 5 member A (Fragment) OS=Homo sapiens OX=9606 GN=GPRC5A PE=1 SV=8
10	Q9JIL6	4.51e-51	176	344	0.283	0.331	GPC5D_MOUSE G-protein coupled receptor family C group 5 member D OS=Mus musculus OX=10090 GN=Gprc5d PE=2 SV=2
11	Q9NZD1	1.11e-41	152	345	0.273	0.319	GPC5D_HUMAN G-protein coupled receptor family C group 5 member D OS=Homo sapiens OX=9606 GN=GPRC5D PE=1 SV=1
12	A1Z7F6	6.88e-12	69.7	780	0.129	0.067	A1Z7F6_DROME Mangetout, isoform C OS=Drosophila melanogaster OX=7227 GN=mtt PE=2 SV=1
13	A1Z7F4	1.01e-11	69.3	1095	0.134	0.049	A1Z7F4_DROME Mangetout, isoform E OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
14	A1Z7F5	1.01e-11	69.3	1248	0.134	0.043	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
15	A0A0B4KF15	1.03e-11	69.3	1472	0.134	0.037	A0A0B4KF15_DROME Mangetout, isoform G OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
16	Q70GQ8	1.17e-11	68.9	1073	0.134	0.050	Q70GQ8_DROME Metabotropic X receptor OS=Drosophila melanogaster OX=7227 GN=mtt PE=2 SV=1
17	B7YZT0	1.20e-11	68.9	1415	0.134	0.038	B7YZT0_DROME Mangetout, isoform D OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
18	P31422	9.24e-11	66.2	879	0.166	0.076	GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1
19	Q9QYS2	1.40e-10	65.5	879	0.164	0.075	GRM3_MOUSE Metabotropic glutamate receptor 3 OS=Mus musculus OX=10090 GN=Grm3 PE=1 SV=1
20	Q14832	4.18e-10	63.9	879	0.174	0.080	GRM3_HUMAN Metabotropic glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRM3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	7.4e-38	142.4	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF20403 DUF6693	1.5e+02	14.0	Family of unknown function (DUF6693)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263985	0.702	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
2	9606.ENSP00000382976	0.693	Lethal(3)malignant brain tumor-like protein 4
3	9606.ENSP00000219069	0.676	Zinc finger protein 263
4	9606.ENSP00000364815	0.670	Valine--tRNA ligase
5	9606.ENSP00000262507	0.669	Ubiquinone biosynthesis protein COQ9, mitochondrial
6	9606.ENSP00000320658	0.660	Tyrosine--tRNA ligase, mitochondrial
7	9606.ENSP00000350364	0.637	Neuronal growth regulator 1
8	9606.ENSP00000321951	0.635	Protein lifeguard 2
9	9606.ENSP00000322251	0.628	Serine/threonine-protein kinase TNNI3K
10	9606.ENSP00000307746	0.615	Zinc finger protein 608
11	9606.ENSP00000441000	0.609	Valine--tRNA ligase, mitochondrial
12	9606.ENSP00000253047	0.602	Transmembrane protein 160
13	9606.ENSP00000316845	0.601	Rho guanine nucleotide exchange factor 4
14	9606.ENSP00000426528	0.595	APC membrane recruitment protein 2
15	9606.ENSP00000262753	0.592	Protein POF1B
16	9606.ENSP00000384193	0.592	Cell adhesion molecule 2
17	9606.ENSP00000397351	0.592	Delphilin
18	9606.ENSP00000324901	0.590	IQ motif containing K
19	9606.ENSP00000306449	0.588	Prosaposin receptor GPR37
20	9606.ENSP00000340578	0.586	Ras association domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.989	molecular function regulator activity
GO:0019900	0.865	kinase binding
GO:0019207	0.821	kinase regulator activity
GO:0019901	0.806	protein kinase binding
GO:0060089	0.698	molecular transducer activity
GO:0038023	0.694	signaling receptor activity
GO:0019209	0.688	kinase activator activity
GO:0019887	0.685	protein kinase regulator activity
GO:0030295	0.662	protein kinase activator activity
GO:0004888	0.459	transmembrane signaling receptor activity
GO:0004930	0.339	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0050896	0.968	response to stimulus
GO:0007154	0.952	cell communication
GO:0051716	0.947	cellular response to stimulus
GO:0023052	0.944	signaling
GO:0007165	0.912	signal transduction
GO:0048583	0.712	regulation of response to stimulus
GO:0010646	0.621	regulation of cell communication
GO:0023051	0.578	regulation of signaling
GO:0019222	0.554	regulation of metabolic process
GO:0048518	0.533	positive regulation of biological process
GO:0071704	0.531	organic substance metabolic process
GO:0044238	0.506	primary metabolic process
GO:0048522	0.487	positive regulation of cellular process
GO:0044237	0.455	cellular metabolic process
GO:0009966	0.441	regulation of signal transduction
GO:0060255	0.399	regulation of macromolecule metabolic process
GO:0007186	0.393	G protein-coupled receptor signaling pathway
GO:0051171	0.387	regulation of nitrogen compound metabolic process
GO:0031323	0.385	regulation of cellular metabolic process
GO:0006807	0.381	nitrogen compound metabolic process
GO:0080090	0.375	regulation of primary metabolic process
GO:0032501	0.350	multicellular organismal process
GO:1902533	0.348	positive regulation of intracellular signal transduction
GO:0010468	0.338	regulation of gene expression
GO:0043170	0.337	macromolecule metabolic process
GO:0050790	0.306	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0070013	0.990	intracellular organelle lumen
GO:0031981	0.982	nuclear lumen
GO:0005829	0.977	cytosol
GO:0016020	0.965	membrane
GO:0005654	0.963	nucleoplasm
GO:0043232	0.904	intracellular non-membrane-bounded organelle
GO:0005730	0.842	nucleolus
GO:0071944	0.839	cell periphery
GO:0005886	0.832	plasma membrane
GO:0005576	0.512	extracellular region
GO:0070062	0.391	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]