StarFunc result for job id Q9NZH6

User Input

>input (218 residues)
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKF
SIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTS
CNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZH6	1.000	1.000	1.064E-37	218	1.000	1.000	Q9NZH6.pdb.gz	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
2	AFDB:Q9D6Z6	0.651	0.770	1.179E-14	183	0.239	0.284	Q9D6Z6.pdb.gz	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
3	AFDB:Q9NZH8	0.626	0.800	4.693E-14	169	0.257	0.331	Q9NZH8.pdb.gz	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
4	AFDB:Q9UHA7	0.646	0.877	8.877E-14	158	0.239	0.329	Q9UHA7.pdb.gz	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
5	PDB:4izeA	0.630	0.889	1.008E-13	152	0.234	0.336	4izeA.pdb.gz
6	AFDB:Q8R460	0.631	0.829	1.679E-13	164	0.206	0.274	Q8R460.pdb.gz	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
7	AFDB:Q9JLA2	0.651	0.875	6.681E-13	160	0.206	0.281	Q9JLA2.pdb.gz	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
8	AFDB:P25086	0.616	0.744	3.117E-12	178	0.202	0.247	P25086.pdb.gz	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
9	PDB:5bowA	0.592	0.837	3.183E-12	151	0.197	0.285	5bowA.pdb.gz
10	AFDB:P18510	0.584	0.711	4.521E-12	177	0.206	0.254	P18510.pdb.gz	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
11	AFDB:P25085	0.637	0.771	9.019E-12	178	0.206	0.253	P25085.pdb.gz	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
12	AFDB:Q8WWZ1	0.594	0.838	9.511E-12	152	0.202	0.289	Q8WWZ1.pdb.gz	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
13	PDB:6hpiA	0.572	0.759	9.710E-12	158	0.234	0.323	6hpiA.pdb.gz
14	PDB:1md6A	0.597	0.829	4.531E-11	154	0.234	0.331	1md6A.pdb.gz
15	PDB:1irpA	0.505	0.679	3.914E-6	153	0.183	0.261	1irpA.pdb.gz
16	PDB:3nbcA	0.475	0.668	1.612E-4	148	0.073	0.108	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
17	PDB:1t9fA	0.470	0.564	8.822E-4	178	0.092	0.112	1t9fA.pdb.gz
18	PDB:4a7zA	0.472	0.133	1.279E-3	881	0.106	0.026	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.
19	PDB:4qd2B	0.453	0.661	1.669E-3	143	0.073	0.112	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
20	PDB:6b0tA	0.474	0.228	1.669E-3	487	0.092	0.041	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZH6	1.92e-163	451	218	1.000	1.000	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
2	Q9NZH8	1.44e-23	94.4	169	0.243	0.314	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
3	Q9D6Z6	6.68e-19	82.8	183	0.211	0.251	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
4	Q9UHA7	9.92e-17	76.3	158	0.248	0.342	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
5	Q9QYY1	6.46e-15	71.2	156	0.229	0.321	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
6	Q8R460	1.10e-14	70.9	164	0.206	0.274	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
7	Q9JLA2	2.19e-14	70.1	160	0.197	0.269	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
8	Q9UBH0	6.19e-13	66.2	155	0.225	0.316	I36RA_HUMAN Interleukin-36 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL36RN PE=1 SV=1
9	F4ZWC1	3.00e-12	66.2	267	0.220	0.180	F4ZWC1_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
10	P25085	1.85e-11	62.8	178	0.202	0.247	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
11	Q8WWZ1	3.79e-11	61.2	152	0.170	0.243	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
12	A3DTN2	4.00e-11	63.2	267	0.216	0.176	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
13	O73909	4.00e-11	63.2	267	0.216	0.176	O73909_CHICK Interleukin-1 OS=Gallus gallus OX=9031 GN=il-1beta PE=1 SV=1
14	E9LHC8	4.04e-11	63.2	267	0.216	0.176	E9LHC8_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
15	A3DTN3	6.28e-11	62.4	267	0.216	0.176	A3DTN3_9AVES Interleukin-1 OS=Anser anser OX=8843 PE=2 SV=1
16	A3DTN5	1.77e-10	61.2	267	0.206	0.169	A3DTN5_MELGA Interleukin-1 OS=Meleagris gallopavo OX=9103 GN=IL1RN PE=2 SV=1
17	P25086	4.67e-10	58.9	178	0.188	0.230	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
18	P18510	8.58e-10	58.2	177	0.183	0.226	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
19	A3DTN4	3.92e-09	57.4	269	0.220	0.178	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
20	E6N152	2.65e-07	52.0	272	0.243	0.195	E6N152_DANRE Interleukin-1 OS=Danio rerio OX=7955 GN=il1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	1.4e-09	49.1	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332973	0.998	Mothers against decapentaplegic homolog 3
2	9606.ENSP00000384212	0.995	Interleukin-18-binding protein
3	9606.ENSP00000387211	0.992	Interleukin-18 receptor 1
4	9606.ENSP00000403104	0.991	Single Ig IL-1-related receptor
5	9606.ENSP00000280357	0.987	Interleukin-18
6	9606.ENSP00000264260	0.968	Interleukin-18 receptor accessory protein
7	9606.ENSP00000264657	0.934	Signal transducer and activator of transcription 3
8	9606.ENSP00000340944	0.908	Tyrosine-protein phosphatase non-receptor type 11
9	9606.ENSP00000329967	0.907	Serine/threonine-protein kinase TBK1
10	9606.ENSP00000391592	0.902	Tyrosine-protein phosphatase non-receptor type 6
11	9606.ENSP00000175756	0.900	Tyrosine-protein phosphatase non-receptor type 18
12	9606.ENSP00000248594	0.900	Tyrosine-protein phosphatase non-receptor type 12
13	9606.ENSP00000263708	0.900	Tyrosine-protein phosphatase non-receptor type 4
14	9606.ENSP00000265562	0.900	Tyrosine-protein phosphatase non-receptor type 23
15	9606.ENSP00000309116	0.900	Tyrosine-protein phosphatase non-receptor type 7
16	9606.ENSP00000311857	0.900	Tyrosine-protein phosphatase non-receptor type 2
17	9606.ENSP00000351342	0.900	Tyrosine-protein phosphatase non-receptor type 5
18	9606.ENSP00000355923	0.900	Tyrosine-protein phosphatase non-receptor type 14
19	9606.ENSP00000363459	0.900	Tyrosine-protein phosphatase non-receptor type 20
20	9606.ENSP00000394794	0.900	Tyrosine-protein phosphatase non-receptor type 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0030545	0.955	signaling receptor regulator activity
GO:0140677	0.947	molecular function activator activity
GO:0005125	0.910	cytokine activity
GO:0005149	0.855	interleukin-1 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031347	0.989	regulation of defense response
GO:0032101	0.969	regulation of response to external stimulus
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:1903555	0.956	regulation of tumor necrosis factor superfamily cytokine production
GO:0051241	0.953	negative regulation of multicellular organismal process
GO:0032675	0.940	regulation of interleukin-6 production
GO:0050727	0.921	regulation of inflammatory response
GO:0001818	0.920	negative regulation of cytokine production
GO:0050794	0.828	regulation of cellular process
GO:0009987	0.816	cellular process
GO:0032680	0.796	regulation of tumor necrosis factor production
GO:0032715	0.795	negative regulation of interleukin-6 production
GO:0050896	0.781	response to stimulus
GO:1903556	0.663	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0048518	0.653	positive regulation of biological process
GO:0051716	0.611	cellular response to stimulus
GO:0006950	0.503	response to stress
GO:0007154	0.475	cell communication
GO:0023052	0.472	signaling
GO:0008152	0.409	metabolic process
GO:0071704	0.399	organic substance metabolic process
GO:0002376	0.361	immune system process
GO:0010604	0.346	positive regulation of macromolecule metabolic process
GO:0007165	0.332	signal transduction
GO:0023051	0.331	regulation of signaling
GO:0010646	0.328	regulation of cell communication
GO:0032501	0.323	multicellular organismal process
GO:0010628	0.310	positive regulation of gene expression
GO:0032720	0.302	negative regulation of tumor necrosis factor production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005829	0.996	cytosol
GO:0005654	0.996	nucleoplasm
GO:0005615	0.630	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]