StarFunc result for job id Q9NZH7

User Input

>input (164 residues)
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGN
MVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFM
GTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZH7	1.000	1.000	4.667E-29	164	1.000	1.000	Q9NZH7.pdb.gz	IL36B_HUMAN Interleukin-36 beta OS=Homo sapiens OX=9606 GN=IL36B PE=1 SV=1
2	AFDB:Q9D6Z6	0.513	0.461	4.494E-9	183	0.311	0.279	Q9D6Z6.pdb.gz	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
3	AFDB:Q9UHA7	0.507	0.526	5.372E-8	158	0.232	0.241	Q9UHA7.pdb.gz	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
4	AFDB:Q9NZH8	0.500	0.486	8.515E-7	169	0.213	0.207	Q9NZH8.pdb.gz	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
5	AFDB:Q8R460	0.473	0.473	1.337E-6	164	0.195	0.195	Q8R460.pdb.gz	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
6	PDB:4izeA	0.474	0.509	4.669E-6	152	0.207	0.224	4izeA.pdb.gz
7	PDB:6hpiA	0.417	0.431	6.190E-6	158	0.226	0.234	6hpiA.pdb.gz
8	AFDB:Q9JLA2	0.504	0.516	8.124E-6	160	0.189	0.194	Q9JLA2.pdb.gz	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
9	AFDB:A3DTN4	0.418	0.264	3.204E-3	269	0.171	0.104	A3DTN4.pdb.gz	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
10	PDB:5bowA	0.420	0.453	3.424E-3	151	0.122	0.132	5bowA.pdb.gz
11	AFDB:A3DTN2	0.417	0.265	4.014E-3	267	0.183	0.112	A3DTN2.pdb.gz	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
12	PDB:1md6A	0.410	0.435	4.291E-3	154	0.146	0.156	1md6A.pdb.gz
13	PDB:1irpA	0.358	0.379	4.848E-2	153	0.122	0.131	1irpA.pdb.gz
14	PDB:4iybA	0.193	0.215	1.195E-1	140	0.098	0.114	4iybA.pdb.gz	Macrolepiota procera ricin B-like lectin (MPL) in complex with galactose
15	PDB:4qd2B	0.303	0.342	2.222E-1	143	0.061	0.070	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	AFDB:Q9C8W9	0.138	0.079	2.462E-1	324	0.140	0.071	Q9C8W9.pdb.gz	NAC30_ARATH NAC domain-containing protein 30 OS=Arabidopsis thaliana OX=3702 GN=NAC030 PE=1 SV=1
17	PDB:3nbcA	0.186	0.202	3.692E-1	148	0.116	0.128	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
18	AFDB:Q27GK5	0.119	0.100	4.090E-1	218	0.079	0.060	Q27GK5.pdb.gz	Q27GK5_ARATH Octicosapeptide/Phox/Bem1p family protein OS=Arabidopsis thaliana OX=3702 GN=At3g26510 PE=1 SV=1
19	PDB:7romA	0.114	0.083	4.372E-1	255	0.079	0.051	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD
20	PDB:4ebrA	0.153	0.159	9.628E-1	157	0.104	0.108	4ebrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZH7	1.67e-122	343	164	1.000	1.000	IL36B_HUMAN Interleukin-36 beta OS=Homo sapiens OX=9606 GN=IL36B PE=1 SV=1
2	Q9D6Z6	4.13e-33	117	183	0.305	0.273	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
3	Q9NZH8	2.10e-18	79.3	169	0.220	0.213	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
4	Q8R460	4.94e-15	70.5	164	0.177	0.177	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
5	Q9UHA7	8.06e-13	64.3	158	0.226	0.234	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
6	Q9JLA2	2.84e-10	57.8	160	0.165	0.169	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
7	Q9NZH6	4.02e-06	47.4	218	0.165	0.124	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
8	Q9PT12	0.051	35.4	254	0.165	0.106	Q9PT12_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=IL-1 beta 2 PE=3 SV=1
9	A0A060Z0U0	0.052	35.4	254	0.165	0.106	A0A060Z0U0_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00016453001 PE=3 SV=1
10	A0A060WTK5	0.16	33.9	260	0.159	0.100	A0A060WTK5_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00005489001 PE=3 SV=1
11	Q9YGD3	0.16	33.9	260	0.159	0.100	IL1B_ONCMY Interleukin-1 beta OS=Oncorhynchus mykiss OX=8022 GN=il1b PE=2 SV=1
12	Q8UUQ3	0.17	33.9	260	0.159	0.100	Q8UUQ3_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=IL1B1S PE=3 SV=1
13	P10749	0.54	32.3	269	0.171	0.104	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1
14	Q8WWZ1	1.2	30.8	152	0.073	0.079	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
15	O43645	1.7	30.4	153	0.183	0.196	O43645_HUMAN Multifunctional fusion protein (Fragment) OS=Homo sapiens OX=9606 GN=IL1b PE=2 SV=1
16	P26889	2.8	30.4	267	0.091	0.056	IL1B_PIG Interleukin-1 beta OS=Sus scrofa OX=9823 GN=IL1B PE=1 SV=1
17	P01584	3.0	30.4	269	0.183	0.112	IL1B_HUMAN Interleukin-1 beta OS=Homo sapiens OX=9606 GN=IL1B PE=1 SV=2
18	P25085	3.0	30.0	178	0.171	0.157	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
19	P25086	3.6	29.6	178	0.146	0.135	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
20	Q6P1J6	4.4	30.0	1458	0.104	0.012	PLB1_HUMAN Phospholipase B1, membrane-associated OS=Homo sapiens OX=9606 GN=PLB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	16	16.6	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376896	0.994	Interleukin-36 receptor antagonist protein
2	9606.ENSP00000264257	0.976	Interleukin-1 receptor-like 2
3	9606.ENSP00000376893	0.975	Interleukin-1 family member 10
4	9606.ENSP00000314807	0.871	Interleukin 1 receptor accessory protein
5	9606.ENSP00000385675	0.763	Interleukin-6
6	9606.ENSP00000259205	0.751	Interleukin-36 gamma
7	9606.ENSP00000259211	0.733	Interleukin-36 alpha
8	9606.ENSP00000398698	0.732	Tumor necrosis factor
9	9606.ENSP00000263339	0.697	Interleukin-1 alpha
10	9606.ENSP00000259206	0.689	Interleukin-1 receptor antagonist protein
11	9606.ENSP00000401399	0.684	Myeloid differentiation primary response protein MyD88
12	9606.ENSP00000305204	0.681	Cytoskeleton-associated protein 2-like
13	9606.ENSP00000263341	0.593	Interleukin-1 beta
14	9606.ENSP00000229135	0.588	Interferon gamma
15	9606.ENSP00000226730	0.575	Interleukin-2
16	9606.ENSP00000386380	0.575	Interleukin-1 receptor type 1
17	9606.ENSP00000255030	0.571	C-reactive protein
18	9606.ENSP00000306512	0.567	Interleukin-8
19	9606.ENSP00000280357	0.557	Interleukin-18
20	9606.ENSP00000282091	0.555	Parathyroid hormone

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0005149	0.957	interleukin-1 receptor binding
GO:0030545	0.851	signaling receptor regulator activity
GO:0030546	0.841	signaling receptor activator activity
GO:0048018	0.710	receptor ligand activity
GO:0005125	0.672	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0048518	0.968	positive regulation of biological process
GO:0010468	0.907	regulation of gene expression
GO:0009893	0.830	positive regulation of metabolic process
GO:0010604	0.801	positive regulation of macromolecule metabolic process
GO:0051239	0.795	regulation of multicellular organismal process
GO:0048519	0.792	negative regulation of biological process
GO:0048522	0.728	positive regulation of cellular process
GO:0050896	0.713	response to stimulus
GO:0010628	0.680	positive regulation of gene expression
GO:0009987	0.657	cellular process
GO:0051240	0.641	positive regulation of multicellular organismal process
GO:0001817	0.594	regulation of cytokine production
GO:0048583	0.552	regulation of response to stimulus
GO:0001819	0.509	positive regulation of cytokine production
GO:0048523	0.495	negative regulation of cellular process
GO:0032501	0.462	multicellular organismal process
GO:0031323	0.448	regulation of cellular metabolic process
GO:0006950	0.437	response to stress
GO:0080090	0.412	regulation of primary metabolic process
GO:0071704	0.395	organic substance metabolic process
GO:0006952	0.382	defense response
GO:0009892	0.364	negative regulation of metabolic process
GO:0002682	0.361	regulation of immune system process
GO:0051171	0.361	regulation of nitrogen compound metabolic process
GO:0002376	0.323	immune system process
GO:0032101	0.304	regulation of response to external stimulus
GO:0048856	0.300	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.794	intracellular anatomical structure
GO:0043226	0.790	organelle
GO:0043227	0.732	membrane-bounded organelle
GO:0043229	0.719	intracellular organelle
GO:0043231	0.662	intracellular membrane-bounded organelle
GO:0005615	0.451	extracellular space
GO:0005737	0.397	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]