StarFunc result for job id Q9NZI2

User Input

>input (227 residues)
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R426	0.905	0.905	6.726E-33	227	0.991	0.991	Q8R426.pdb.gz	KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnip1 PE=1 SV=2
2	PDB:1s1eA	0.746	0.927	2.539E-25	181	0.784	0.983	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
3	AFDB:Q6PHZ8	0.819	0.746	2.961E-25	250	0.678	0.616	Q6PHZ8.pdb.gz	KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1
4	AFDB:Q9JM47	0.790	0.703	3.939E-24	256	0.612	0.543	Q9JM47.pdb.gz	CSEN_RAT Calsenilin OS=Rattus norvegicus OX=10116 GN=Kcnip3 PE=1 SV=1
5	AFDB:Q9JJ69	0.797	0.674	4.149E-24	270	0.639	0.537	Q9JJ69.pdb.gz	KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus OX=10090 GN=Kcnip2 PE=1 SV=2
6	AFDB:A2AHT3	0.790	0.634	8.131E-24	284	0.617	0.493	A2AHT3.pdb.gz	A2AHT3_MOUSE Kv channel interacting protein 3, calsenilin OS=Mus musculus OX=10090 GN=Kcnip3 PE=1 SV=1
7	AFDB:A0A2R8QMM6	0.779	0.668	7.151E-23	266	0.608	0.519	A0A2R8QMM6.pdb.gz
8	PDB:7ukhI	0.718	0.888	8.595E-22	181	0.581	0.729	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
9	AFDB:A0A024R8B2	0.769	0.914	1.560E-18	190	0.366	0.437	A0A024R8B2.pdb.gz
10	PDB:2julA	0.706	0.870	1.563E-18	181	0.577	0.724	2julA.pdb.gz	NMR structure of DREAM: Implications for Ca(2+)-dependent DNA binding and protein dimerization.
11	AFDB:Q06389	0.756	0.895	7.765E-18	190	0.344	0.411	Q06389.pdb.gz	NCS1_YEAST Calcium-binding protein NCS-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRQ1 PE=1 SV=2
12	AFDB:Q4WLA4	0.741	0.879	8.178E-18	190	0.339	0.405	Q4WLA4.pdb.gz	Q4WLA4_ASPFU Calcium sensor (NCS-1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G14240 PE=4 SV=1
13	AFDB:P36608	0.764	0.902	8.612E-18	191	0.330	0.393	P36608.pdb.gz	NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans OX=6239 GN=ncs-1 PE=2 SV=2
14	PDB:5aanA	0.693	0.851	2.434E-15	183	0.330	0.410	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
15	PDB:2d8nA	0.635	0.721	2.638E-12	197	0.269	0.310	2d8nA.pdb.gz
16	PDB:2lcpA	0.572	0.666	3.418E-12	190	0.352	0.421	2lcpA.pdb.gz	The C-terminal tail of human neuronal calcium sensor 1 regulates the conformational stability of the ca(2+)-activated state.
17	PDB:1fpwA	0.629	0.736	1.701E-11	190	0.348	0.416	1fpwA.pdb.gz	Structure and calcium-binding properties of Frq1, a novel calcium sensor in the yeast Saccharomyces cerevisiae.
18	PDB:1omrA	0.620	0.691	4.100E-11	201	0.273	0.308	1omrA.pdb.gz	Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
19	PDB:5x9aB	0.606	0.686	1.069E-9	198	0.211	0.242	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
20	PDB:1v1fA	0.614	0.728	3.011E-9	188	0.225	0.271	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZI2	3.61e-174	479	227	1.000	1.000	KCIP1_HUMAN Kv channel-interacting protein 1 OS=Homo sapiens OX=9606 GN=KCNIP1 PE=1 SV=2
2	Q9JJ57	1.13e-173	478	227	0.996	0.996	KCIP1_MOUSE Kv channel-interacting protein 1 OS=Mus musculus OX=10090 GN=Kcnip1 PE=1 SV=2
3	Q8R426	6.19e-173	476	227	0.991	0.991	KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnip1 PE=1 SV=2
4	Q6PIL6	1.91e-118	339	250	0.665	0.604	KCIP4_HUMAN Kv channel-interacting protein 4 OS=Homo sapiens OX=9606 GN=KCNIP4 PE=1 SV=1
5	Q6PHZ8	2.15e-118	339	250	0.665	0.604	KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1
6	Q99MG9	2.15e-118	339	250	0.665	0.604	KCIP4_RAT Kv channel-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Kcnip4 PE=1 SV=1
7	Q9JM59	3.02e-112	324	270	0.617	0.519	KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnip2 PE=1 SV=2
8	Q9JJ69	5.34e-112	323	270	0.617	0.519	KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus OX=10090 GN=Kcnip2 PE=1 SV=2
9	Q9NS61	9.33e-112	323	270	0.617	0.519	KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens OX=9606 GN=KCNIP2 PE=1 SV=3
10	Q9JM47	2.10e-108	314	256	0.608	0.539	CSEN_RAT Calsenilin OS=Rattus norvegicus OX=10116 GN=Kcnip3 PE=1 SV=1
11	Q9Y2W7	4.61e-108	313	256	0.604	0.535	CSEN_HUMAN Calsenilin OS=Homo sapiens OX=9606 GN=KCNIP3 PE=1 SV=1
12	Q9QXT8	5.71e-107	310	256	0.604	0.535	CSEN_MOUSE Calsenilin OS=Mus musculus OX=10090 GN=Kcnip3 PE=1 SV=2
13	A2AHT3	4.60e-106	309	284	0.599	0.479	A2AHT3_MOUSE Kv channel interacting protein 3, calsenilin OS=Mus musculus OX=10090 GN=Kcnip3 PE=1 SV=1
14	Q6PBP8	1.61e-105	306	259	0.604	0.529	Q6PBP8_DANRE Kv channel interacting protein 3, calsenilin OS=Danio rerio OX=7955 GN=kcnip3 PE=2 SV=1
15	Q9VBL2	1.03e-70	217	229	0.445	0.441	Q9VBL2_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5890 PE=4 SV=2
16	P62166	3.81e-57	181	190	0.366	0.437	NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens OX=9606 GN=NCS1 PE=1 SV=2
17	P62167	3.81e-57	181	190	0.366	0.437	NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus OX=9031 GN=NCS1 PE=1 SV=2
18	P62168	3.81e-57	181	190	0.366	0.437	NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus OX=10116 GN=Ncs1 PE=1 SV=2
19	Q8BNY6	3.81e-57	181	190	0.366	0.437	NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus OX=10090 GN=Ncs1 PE=1 SV=3
20	Q804C0	9.83e-57	180	190	0.361	0.432	Q804C0_DANRE Neuronal calcium sensor 1 OS=Danio rerio OX=7955 GN=ncs1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	6e-15	64.7	EF hand
2	PF14788 EF-hand_10	3.5e+02	12.5	EF hand
3	PF12763 EF-hand_4	21	16.5	Cytoskeletal-regulatory complex EF hand
4	PF13202 EF-hand_5	4.1e-08	43.5	EF hand
5	PF13405 EF-hand_6	1.9e-11	53.8	EF-hand domain
6	PF13499 EF-hand_7	1e-18	78.8	EF-hand domain pair
7	PF13833 EF-hand_8	6.5e-11	53.2	EF-hand domain pair
8	PF14658 EF-hand_9	1.3	20.8	EF-hand domain
9	PF10591 SPARC_Ca_bdg	0.073	24.8	Secreted protein acidic and rich in cysteine Ca binding region
10	PF00992 Troponin	1.7e+02	13.8	Troponin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000017946

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000020122	0.952	Uncharacterized protein
2	9601.ENSPPYP00000001194	0.929	Potassium voltage-gated channel, Shal-related subfamily, member 3
3	9601.ENSPPYP00000022755	0.868	Potassium voltage-gated channel, Shal-related subfamily, member 1
4	9601.ENSPPYP00000022756	0.868	Uncharacterized protein
5	9601.ENSPPYP00000016349	0.824	Kv channel-interacting protein 4
6	9601.ENSPPYP00000002513	0.805	Prenyl (decaprenyl) diphosphate synthase, subunit 1
7	9601.ENSPPYP00000003012	0.801	Kv channel interacting protein 2
8	9601.ENSPPYP00000003960	0.768	Potassium voltage-gated channel, Shaw-related subfamily, member 1
9	9601.ENSPPYP00000003900	0.759	Uncharacterized protein DKFZp459N0126
10	9601.ENSPPYP00000019715	0.693	DEAD-box helicase 56
11	9601.ENSPPYP00000007417	0.688	Gamma-secretase subunit APH-1B
12	9601.ENSPPYP00000015265	0.675	Transporter
13	9601.ENSPPYP00000020414	0.662	Belongs to the peptidase S9B family.
14	9601.ENSPPYP00000003088	0.647	Leucine-rich repeat protein SHOC-2
15	9601.ENSPPYP00000017781	0.620	Sprouty RTK signaling antagonist 4
16	9601.ENSPPYP00000024295	0.599	CRK like proto-oncogene, adaptor protein
17	9601.ENSPPYP00000014280	0.575	Belongs to the peptidase S9B family.
18	9601.ENSPPYP00000023578	0.566	TSC22 domain family protein 3
19	9601.ENSPPYP00000001015	0.560	Phosphatidylinositol 4-kinase, catalytic, beta
20	9601.ENSPPYP00000007452	0.540	Solute carrier family 24 (sodium/potassium/calcium exchanger), member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015459	1.000	potassium channel regulator activity
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0034762	0.887	regulation of transmembrane transport
GO:0043269	0.881	regulation of monoatomic ion transport
GO:0042391	0.874	regulation of membrane potential
GO:0010959	0.861	regulation of metal ion transport
GO:0043266	0.850	regulation of potassium ion transport
GO:0034765	0.841	regulation of monoatomic ion transmembrane transport
GO:1904062	0.822	regulation of monoatomic cation transmembrane transport
GO:0048518	0.638	positive regulation of biological process
GO:0009987	0.618	cellular process
GO:0098900	0.534	regulation of action potential
GO:1901379	0.534	regulation of potassium ion transmembrane transport
GO:0048856	0.351	anatomical structure development
GO:0050896	0.343	response to stimulus
GO:0032501	0.338	multicellular organismal process
GO:0048522	0.329	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0034705	0.995	potassium channel complex
GO:0008076	0.956	voltage-gated potassium channel complex
GO:0005622	0.901	intracellular anatomical structure
GO:0043025	0.781	neuronal cell body
GO:0005737	0.779	cytoplasm
GO:0043005	0.742	neuron projection
GO:0097447	0.713	dendritic tree
GO:0030425	0.691	dendrite
GO:0043226	0.613	organelle
GO:0043229	0.379	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]