StarFunc result for job id Q9NZI5

User Input

>input (618 residues)
MTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDSAAA
LGLLYDYYKVPRERRSSTAKPEVEHPEPDHSKRNSIPIVTEQPLISAGENRVQVLKNVPF
NIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPT
ERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFSETFKEGVQEVFFPSDLSLRMPGMNSE
DYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFYPITLKEVSSSEGIHHPISKV
RSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISNIEEIAYNAIS
FTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQVDTYSYNNRSNKPVHRAYCQIKVF
CDKGAERKIRDEERKQSKRKVSDVKVPLLPSHKRMDITVFKPFIDLDTQPVLFIPDVHFA
NLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESE
EVFDALMLKTPSLKGLMEAISDKYDVPHDKIGKIFKKCKKGILVNMDDNIVKHYSNEDTF
QLQIEEAGGSYKLTLTEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q921D9	0.410	0.410	0.000	618	0.947	0.947	Q921D9.pdb.gz	GRHL1_MOUSE Grainyhead-like protein 1 homolog OS=Mus musculus OX=10090 GN=Grhl1 PE=1 SV=1
2	AFDB:E7FCE3	0.402	0.405	6.754E-84	613	0.699	0.705	E7FCE3.pdb.gz	E7FCE3_DANRE Grainyhead-like protein 1 homolog isoform X1 OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=1
3	AFDB:Q6ISB3	0.365	0.361	2.932E-77	625	0.586	0.579	Q6ISB3.pdb.gz	GRHL2_HUMAN Grainyhead-like protein 2 homolog OS=Homo sapiens OX=9606 GN=GRHL2 PE=1 SV=1
4	AFDB:F7VJQ5	0.498	0.511	1.904E-75	601	0.566	0.582	F7VJQ5.pdb.gz	F7VJQ5_DANRE Grainyhead-like 2b protein OS=Danio rerio OX=7955 GN=grhl2 PE=2 SV=1
5	AFDB:Q8TE85	0.437	0.431	1.149E-54	626	0.437	0.431	Q8TE85.pdb.gz	GRHL3_HUMAN Grainyhead-like protein 3 homolog OS=Homo sapiens OX=9606 GN=GRHL3 PE=1 SV=3
6	AFDB:Q54XS3	0.111	0.049	2.716E-5	1661	0.078	0.029	Q54XS3.pdb.gz	GDT1_DICDI Probable inactive serine/threonine-protein kinase gdt1 OS=Dictyostelium discoideum OX=44689 GN=gdt1 PE=1 SV=1
7	PDB:6xreM	0.160	0.288	4.027E-5	314	0.058	0.115	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
8	AFDB:Q9Y2G1	0.127	0.076	1.890E-4	1151	0.094	0.050	Q9Y2G1.pdb.gz	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
9	AFDB:P79944	0.112	0.102	1.102E-3	692	0.102	0.091	P79944.pdb.gz	EOMES_XENLA Eomesodermin OS=Xenopus laevis OX=8355 GN=eomes PE=2 SV=1
10	PDB:1q90A	0.126	0.227	1.370E-3	292	0.023	0.048	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
11	AFDB:F4I316	0.076	0.073	1.663E-3	660	0.092	0.086	F4I316.pdb.gz	SUN3_ARATH SUN domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=SUN3 PE=1 SV=1
12	AFDB:Q8IX03	0.094	0.058	4.792E-3	1113	0.104	0.058	Q8IX03.pdb.gz	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
13	PDB:1yvlB	0.111	0.107	5.616E-3	653	0.029	0.028	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
14	PDB:4n20A	0.149	0.145	5.616E-3	639	0.031	0.030	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
15	PDB:4n2iA	0.132	0.124	7.535E-3	662	0.028	0.026	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
16	PDB:7ea3J	0.133	0.096	7.992E-3	883	0.026	0.018	7ea3J.pdb.gz
17	PDB:7tvzE	0.131	0.123	8.989E-3	665	0.031	0.029	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
18	PDB:3oaiA	0.107	0.131	1.011E-2	488	0.023	0.029	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
19	PDB:3s3sA	0.116	0.116	1.011E-2	620	0.018	0.018	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
20	PDB:4nehA	0.118	0.073	1.279E-2	1084	0.031	0.018	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YAF2	0.0	848	601	0.706	0.725	A0A286YAF2_DANRE Grainyhead-like protein 1 homolog OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=2
2	A0A2R8QAV0	0.0	608	554	0.526	0.587	A0A2R8QAV0_DANRE Grainyhead-like protein 2 homolog OS=Danio rerio OX=7955 GN=grhl2 PE=4 SV=1
3	E7FCE3	0.0	840	613	0.704	0.710	E7FCE3_DANRE Grainyhead-like protein 1 homolog isoform X1 OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=1
4	F7VJQ5	0.0	674	601	0.579	0.596	F7VJQ5_DANRE Grainyhead-like 2b protein OS=Danio rerio OX=7955 GN=grhl2 PE=2 SV=1
5	Q6ISB3	0.0	691	625	0.587	0.581	GRHL2_HUMAN Grainyhead-like protein 2 homolog OS=Homo sapiens OX=9606 GN=GRHL2 PE=1 SV=1
6	Q8K5C0	0.0	694	625	0.584	0.578	GRHL2_MOUSE Grainyhead-like protein 2 homolog OS=Mus musculus OX=10090 GN=Grhl2 PE=2 SV=1
7	Q921D9	0.0	1222	618	0.947	0.947	GRHL1_MOUSE Grainyhead-like protein 1 homolog OS=Mus musculus OX=10090 GN=Grhl1 PE=1 SV=1
8	Q9NZI5	0.0	1287	618	1.000	1.000	GRHL1_HUMAN Grainyhead-like protein 1 homolog OS=Homo sapiens OX=9606 GN=GRHL1 PE=1 SV=2
9	Q5FWH3	9.40e-163	480	603	0.476	0.488	GRHL3_MOUSE Grainyhead-like protein 3 homolog OS=Mus musculus OX=10090 GN=Grhl3 PE=1 SV=1
10	Q8TE85	5.19e-152	454	626	0.443	0.438	GRHL3_HUMAN Grainyhead-like protein 3 homolog OS=Homo sapiens OX=9606 GN=GRHL3 PE=1 SV=3
11	G5EDF0	3.80e-81	268	563	0.254	0.279	GRH1_CAEEL Grainyhead-like protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=grh-1 PE=2 SV=1
12	P13002	1.93e-59	218	1333	0.186	0.086	ELF1_DROME Protein grainyhead OS=Drosophila melanogaster OX=7227 GN=grh PE=1 SV=3
13	Q9NZI6	3.01e-23	105	479	0.188	0.242	TF2L1_HUMAN Transcription factor CP2-like protein 1 OS=Homo sapiens OX=9606 GN=TFCP2L1 PE=1 SV=1
14	F8VX55	4.53e-23	104	424	0.167	0.243	F8VX55_HUMAN Transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2 PE=1 SV=1
15	Q3UNW5	5.68e-22	101	479	0.121	0.157	TF2L1_MOUSE Transcription factor CP2-like protein 1 OS=Mus musculus OX=10090 GN=Tfcp2l1 PE=1 SV=2
16	Q811S7	6.72e-22	102	540	0.131	0.150	UBIP1_MOUSE Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1
17	Q9NZI7	4.84e-21	99.4	540	0.113	0.130	UBIP1_HUMAN Upstream-binding protein 1 OS=Homo sapiens OX=9606 GN=UBP1 PE=1 SV=1
18	Q9ERA0	1.45e-20	97.8	502	0.121	0.149	TFCP2_MOUSE Alpha-globin transcription factor CP2 OS=Mus musculus OX=10090 GN=Tfcp2 PE=1 SV=1
19	A0A8I6AB07	2.34e-20	97.1	497	0.118	0.147	A0A8I6AB07_RAT Transcription factor CP2 OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=1 SV=1
20	G3V969	2.50e-20	97.1	497	0.118	0.147	G3V969_RAT Tcfcp2 protein OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04516 CP2	1.8e-76	268.0	CP2 transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419692	0.913	Retinoic acid receptor RXR-alpha
2	9606.ENSP00000300651	0.910	Mediator of RNA polymerase II transcription subunit 1
3	9606.ENSP00000262188	0.906	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
4	9606.ENSP00000262367	0.905	CREB-binding protein
5	9606.ENSP00000325690	0.905	Histone-arginine methyltransferase CARM1
6	9606.ENSP00000385523	0.905	Peroxisome proliferator-activated receptor alpha
7	9606.ENSP00000385216	0.903	Nuclear receptor coactivator 1
8	9606.ENSP00000399968	0.903	Nuclear receptor coactivator 2
9	9606.ENSP00000260129	0.902	Trimethylguanosine synthase
10	9606.ENSP00000457466	0.901	Chromodomain-helicase-DNA-binding protein 9
11	9606.ENSP00000217964	0.900	F-box-like/WD repeat-containing protein TBL1X
12	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
13	9606.ENSP00000405574	0.900	F-box-like/WD repeat-containing protein TBL1XR1
14	9606.ENSP00000417401	0.900	Helicase with zinc finger domain 2
15	9606.ENSP00000295834	0.650	Fatty acid-binding protein, liver
16	9606.ENSP00000204517	0.648	Transcription factor AP-4
17	9606.ENSP00000371212	0.609	RNA-binding protein 47
18	9606.ENSP00000321537	0.576	Lethal(2) giant larvae protein homolog 1
19	9606.ENSP00000405738	0.564	Epithelial splicing regulatory protein 1
20	9606.ENSP00000278780	0.540	Transcription factor Ovo-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0003682	0.999	chromatin binding
GO:0005515	0.980	protein binding
GO:0000981	0.960	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.357	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.974	cellular process
GO:0048522	0.944	positive regulation of cellular process
GO:0006355	0.936	regulation of DNA-templated transcription
GO:0010604	0.918	positive regulation of macromolecule metabolic process
GO:0051173	0.905	positive regulation of nitrogen compound metabolic process
GO:0045935	0.901	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.900	positive regulation of cellular biosynthetic process
GO:0010557	0.893	positive regulation of macromolecule biosynthetic process
GO:0051254	0.884	positive regulation of RNA metabolic process
GO:0006357	0.872	regulation of transcription by RNA polymerase II
GO:0045893	0.841	positive regulation of DNA-templated transcription
GO:0032502	0.783	developmental process
GO:0048856	0.767	anatomical structure development
GO:0045944	0.643	positive regulation of transcription by RNA polymerase II
GO:0009888	0.378	tissue development
GO:0048513	0.344	animal organ development
GO:0071840	0.308	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.603	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]