StarFunc result for job id Q9NZI8

User Input

>input (577 residues)
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88477	0.741	0.741	0.000	577	0.993	0.993	O88477.pdb.gz	IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus OX=10090 GN=Igf2bp1 PE=1 SV=1
2	AFDB:Q08CK7	0.884	0.854	2.778E-95	598	0.797	0.769	Q08CK7.pdb.gz	IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio OX=7955 GN=igf2bp1 PE=1 SV=1
3	AFDB:O73932	0.874	0.850	1.650E-92	594	0.769	0.747	O73932.pdb.gz	IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis OX=8355 GN=igf2bp3-a PE=1 SV=1
4	AFDB:Q9PW80	0.807	0.801	1.037E-89	582	0.726	0.720	Q9PW80.pdb.gz	IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio OX=7955 GN=igf2bp3 PE=1 SV=1
5	AFDB:O00425	0.770	0.768	1.852E-88	579	0.730	0.727	O00425.pdb.gz	IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2
6	AFDB:Q9Y6M1	0.739	0.714	1.634E-85	599	0.679	0.654	Q9Y6M1.pdb.gz	IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2
7	AFDB:M9NF14	0.406	0.378	1.789E-52	638	0.369	0.334	M9NF14.pdb.gz	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
8	AFDB:Q0WNX3	0.343	0.357	1.351E-25	548	0.159	0.168	Q0WNX3.pdb.gz	Q0WNX3_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g15270 PE=1 SV=1
9	AFDB:Q9XI71	0.262	0.308	2.817E-25	479	0.166	0.200	Q9XI71.pdb.gz	Q9XI71_ARATH F7A19.25 protein OS=Arabidopsis thaliana OX=3702 GN=At1g14170 PE=1 SV=1
10	AFDB:A0A178WDD2	0.257	0.240	1.719E-24	621	0.158	0.147	A0A178WDD2.pdb.gz	A0A178WDD2_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At1g51580 PE=1 SV=1
11	PDB:5lsbA	0.148	0.414	7.845E-10	176	0.059	0.193	5lsbA.pdb.gz
12	PDB:6y5qq	0.118	0.362	3.411E-9	178	0.052	0.169	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:5vsuA	0.133	0.190	1.569E-8	387	0.071	0.106	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:7evoD	0.121	0.330	3.461E-8	200	0.045	0.130	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
15	PDB:7oqcF	0.124	0.257	8.080E-8	267	0.052	0.112	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
16	PDB:6y53o	0.143	0.434	1.685E-7	160	0.057	0.206	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:6r5kH	0.124	0.177	2.235E-7	394	0.075	0.109	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:6ff7X	0.117	0.370	1.218E-6	171	0.054	0.181	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7dvqI	0.158	0.620	1.550E-5	128	0.040	0.180	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:3lqvB	0.131	0.614	9.456E-5	115	0.038	0.191	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00425	0.0	860	579	0.749	0.746	IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2
2	O42254	0.0	1098	576	0.945	0.946	IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus OX=9031 GN=IGF2BP1 PE=1 SV=1
3	O73932	0.0	882	594	0.764	0.742	IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis OX=8355 GN=igf2bp3-a PE=1 SV=1
4	O88477	0.0	1181	577	0.993	0.993	IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus OX=10090 GN=Igf2bp1 PE=1 SV=1
5	Q08CK7	0.0	932	598	0.795	0.768	IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio OX=7955 GN=igf2bp1 PE=1 SV=1
6	Q5SF07	0.0	795	592	0.679	0.662	IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus OX=10090 GN=Igf2bp2 PE=1 SV=1
7	Q8CGX0	0.0	1186	577	0.997	0.997	IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igf2bp1 PE=1 SV=1
8	Q9CPN8	0.0	843	579	0.737	0.734	IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus OX=10090 GN=Igf2bp3 PE=1 SV=1
9	Q9NZI8	0.0	1189	577	1.000	1.000	IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2
10	Q9PW80	0.0	851	582	0.737	0.730	IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio OX=7955 GN=igf2bp3 PE=1 SV=1
11	Q9Y6M1	0.0	780	599	0.662	0.638	IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2
12	Q0KHU2	1.22e-117	364	631	0.360	0.330	Q0KHU2_DROME IGF-II mRNA-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
13	M9NF14	1.45e-117	364	638	0.360	0.326	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
14	Q8IR99	6.50e-105	329	573	0.326	0.328	Q8IR99_DROME IGF-II mRNA-binding protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
15	Q9VZ69	9.83e-105	328	566	0.312	0.318	Q9VZ69_DROME IGF-II mRNA-binding protein OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
16	E1JJM0	2.18e-104	328	580	0.326	0.324	E1JJM0_DROME FI20063p1 OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
17	Q8IGK4	1.37e-103	326	580	0.324	0.322	Q8IGK4_DROME RE72930p OS=Drosophila melanogaster OX=7227 GN=Imp PE=2 SV=1
18	O74919	1.00e-15	81.6	398	0.158	0.229	RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rnc1 PE=1 SV=1
19	Q7ZVK5	5.86e-14	75.5	318	0.142	0.258	Q7ZVK5_DANRE Pcbp2 protein OS=Danio rerio OX=7955 GN=PCBP2 PE=1 SV=1
20	Q0WNX3	4.23e-13	74.3	548	0.151	0.159	Q0WNX3_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g15270 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01368 DHH	7.2e+02	11.9	DHH family
2	PF13250 DUF4041	79	14.6	Domain of unknown function (DUF4041)
3	PF00013 KH_1	1.6e-52	186.5	KH domain
4	PF07650 KH_2	4.8e-15	66.5	KH domain
5	PF13083 KH_4	2.5e-12	57.8	KH domain
6	PF13184 KH_5	0.0076	27.7	NusA-like KH domain
7	PF16005 MOEP19	2.4e-05	35.5	KH-like RNA-binding domain
8	PF00076 RRM_1	1.4e-12	58.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
9	PF13893 RRM_5	19	16.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
10	PF16842 RRM_occluded	5.8	18.2	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008836519.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008839689.1	0.979	Insulin like growth factor 2 mRNA binding protein 3
2	1026970.XP_008828892.1	0.954	Synaptotagmin binding cytoplasmic RNA interacting protein
3	1026970.XP_008841052.1	0.937	Y-box binding protein 1
4	1026970.XP_008847376.1	0.929	Heterogeneous nuclear ribonucleoprotein U
5	1026970.XP_008832228.1	0.912	Cold shock domain-containing protein E1 isoform X1
6	1026970.XP_008831980.1	0.802	ATP-dependent RNA helicase A-like
7	1026970.XP_008838453.1	0.802	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: added 388 bases not found in genome assembly
8	1026970.XP_008845595.1	0.802	ATP-dependent RNA helicase A-like
9	1026970.XP_008846801.1	0.768	Heterogeneous nuclear ribonucleoprotein R isoform X1
10	1026970.XP_008837102.1	0.700	Y-box binding protein 3
11	1026970.XP_008835038.1	0.698	Protein lin-28 homolog A
12	1026970.XP_008827322.1	0.659	Cullin 7
13	1026970.XP_008848544.1	0.650	Protein lin-28 homolog B
14	1026970.XP_008853211.1	0.622	Heterogeneous nuclear ribonucleoprotein U like 1
15	1026970.XP_008854063.1	0.620	Y-box-binding protein 2 isoform X1
16	1026970.XP_008822364.1	0.614	ELAV like RNA binding protein 1
17	1026970.XP_008840578.1	0.601	Gem nuclear organelle associated protein 5
18	1026970.XP_008848933.1	0.598	Mitogen-activated protein kinase 4 isoform X1
19	1026970.XP_008825459.1	0.581	RNA-binding protein 47 isoform X1
20	1026970.XP_008834973.1	0.581	APOBEC1 complementation factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0005515	0.999	protein binding
GO:0048027	0.947	mRNA 5'-UTR binding
GO:1990247	0.939	N6-methyladenosine-containing RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0010468	0.975	regulation of gene expression
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0080090	0.972	regulation of primary metabolic process
GO:0048519	0.970	negative regulation of biological process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0010605	0.959	negative regulation of macromolecule metabolic process
GO:0010608	0.940	post-transcriptional regulation of gene expression
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0043488	0.909	regulation of mRNA stability
GO:0031324	0.900	negative regulation of cellular metabolic process
GO:0051172	0.897	negative regulation of nitrogen compound metabolic process
GO:0017148	0.885	negative regulation of translation
GO:0032501	0.879	multicellular organismal process
GO:0071704	0.867	organic substance metabolic process
GO:0048522	0.841	positive regulation of cellular process
GO:1902369	0.827	negative regulation of RNA catabolic process
GO:0043489	0.824	RNA stabilization
GO:1903312	0.813	negative regulation of mRNA metabolic process
GO:0044238	0.805	primary metabolic process
GO:0016043	0.787	cellular component organization
GO:0010628	0.781	positive regulation of gene expression
GO:0007275	0.775	multicellular organism development
GO:0031344	0.770	regulation of cell projection organization
GO:1902373	0.766	negative regulation of mRNA catabolic process
GO:0006807	0.757	nitrogen compound metabolic process
GO:0048731	0.745	system development
GO:0044237	0.744	cellular metabolic process
GO:0007399	0.737	nervous system development
GO:0048255	0.722	mRNA stabilization
GO:0051179	0.706	localization
GO:0043170	0.702	macromolecule metabolic process
GO:0033036	0.695	macromolecule localization
GO:0048666	0.565	neuron development
GO:0030030	0.541	cell projection organization
GO:0050896	0.526	response to stimulus
GO:0051173	0.481	positive regulation of nitrogen compound metabolic process
GO:0031325	0.481	positive regulation of cellular metabolic process
GO:0034641	0.441	cellular nitrogen compound metabolic process
GO:0016358	0.425	dendrite development
GO:0010467	0.406	gene expression
GO:0009653	0.400	anatomical structure morphogenesis
GO:0000902	0.333	cell morphogenesis
GO:1901360	0.308	organic cyclic compound metabolic process
GO:0010557	0.304	positive regulation of macromolecule biosynthetic process
GO:0031328	0.304	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.997	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0005829	0.983	cytosol
GO:1990904	0.966	ribonucleoprotein complex
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0099080	0.786	supramolecular complex
GO:0035770	0.745	ribonucleoprotein granule
GO:0036464	0.655	cytoplasmic ribonucleoprotein granule
GO:0120025	0.637	plasma membrane bounded cell projection
GO:0043005	0.628	neuron projection
GO:0000932	0.443	P-body
GO:0010494	0.405	cytoplasmic stress granule
GO:0036477	0.303	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]