StarFunc result for job id Q9NZJ0

User Input

>input (730 residues)
MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSA
PNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQ
TAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYR
QVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGII
KVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNM
TGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHS
QEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGL
VTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPI
NRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQ
AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSK
DSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENK
NWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVTITPSSMRKICTYFHRKSQED
FCGPEHSTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZJ0	1.000	1.000	0.000	730	1.000	1.000	Q9NZJ0.pdb.gz	DTL_HUMAN Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3
2	AFDB:Q6P1W0	0.586	0.599	9.818E-81	713	0.573	0.586	Q6P1W0.pdb.gz	DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis OX=8364 GN=dtl PE=1 SV=1
3	PDB:2h9lA	0.393	0.862	2.518E-22	321	0.108	0.246	2h9lA.pdb.gz
4	PDB:5mqfF	0.369	0.847	6.760E-22	307	0.111	0.264	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
5	PDB:3jb9L	0.369	0.887	5.149E-21	293	0.101	0.253	3jb9L.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	PDB:5yzgW	0.374	0.605	1.239E-20	440	0.104	0.173	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome
7	PDB:5nnzA	0.321	0.637	2.030E-20	335	0.104	0.227	5nnzA.pdb.gz
8	PDB:5mzhB	0.337	0.557	2.145E-20	415	0.090	0.159	5mzhB.pdb.gz
9	PDB:6bk8M	0.366	0.789	2.529E-20	326	0.074	0.166	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
10	PDB:5o9zL	0.364	0.567	4.885E-20	459	0.096	0.153	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
11	PDB:7mq8LU	0.364	0.580	5.760E-20	445	0.101	0.166	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6bk8D	0.367	0.720	1.547E-19	359	0.082	0.167	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
13	AFDB:Q9C0J8	0.365	0.204	3.969E-19	1336	0.163	0.089	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
14	AFDB:Q6NS57	0.362	0.184	2.433E-17	1503	0.155	0.075	Q6NS57.pdb.gz	MABP1_MOUSE Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1
15	AFDB:B3H5K9	0.339	0.317	2.721E-16	782	0.152	0.142	B3H5K9.pdb.gz	NEDD1_ARATH Protein NEDD1 OS=Arabidopsis thaliana OX=3702 GN=NEDD1 PE=2 SV=1
16	AFDB:O15040	0.315	0.176	2.598E-12	1411	0.127	0.066	O15040.pdb.gz	TCPR2_HUMAN Tectonin beta-propeller repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=TECPR2 PE=1 SV=4
17	AFDB:Q8I5B3	0.245	0.222	4.048E-10	822	0.153	0.136	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
18	AFDB:Q09847	0.205	0.123	9.241E-9	1325	0.144	0.079	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
19	AFDB:Q3UPL0	0.355	0.217	1.357E-8	1230	0.160	0.095	Q3UPL0.pdb.gz	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
20	AFDB:Q9NRJ4	0.307	0.155	1.219E-7	1543	0.148	0.070	Q9NRJ4.pdb.gz	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5GZ90	0.0	1392	688	0.942	1.000	F5GZ90_HUMAN Denticleless E3 ubiquitin protein ligase homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=1
2	Q5RHI5	0.0	602	647	0.489	0.552	DTL_DANRE Denticleless protein homolog OS=Danio rerio OX=7955 GN=dtl PE=2 SV=1
3	Q6P1W0	0.0	786	713	0.574	0.588	DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis OX=8364 GN=dtl PE=1 SV=1
4	Q9NZJ0	0.0	1503	730	1.000	1.000	DTL_HUMAN Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3
5	Q24371	1.76e-89	298	769	0.204	0.194	L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster OX=7227 GN=l(2)dtl PE=1 SV=2
6	Q22059	1.71e-31	133	682	0.138	0.148	Q22059_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cdt-2 PE=1 SV=2
7	Q10990	2.15e-20	97.4	490	0.132	0.196	CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdt2 PE=1 SV=1
8	A0MNP2	4.14e-18	89.0	357	0.108	0.221	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1
9	Q96DI7	4.14e-18	89.0	357	0.108	0.221	SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1
10	O22826	3.28e-17	85.9	343	0.107	0.227	O22826_ARATH At2g43770 OS=Arabidopsis thaliana OX=3702 GN=At2g43770 PE=1 SV=1
11	P41318	2.47e-16	82.8	303	0.108	0.261	LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LST8 PE=1 SV=1
12	Q9VPL0	6.14e-16	82.0	347	0.107	0.225	Q9VPL0_DROME GM13767p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3436 PE=1 SV=1
13	Q8N136	1.05e-14	79.3	415	0.110	0.193	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
14	D3Z7A5	3.34e-14	77.8	415	0.110	0.193	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
15	Q54KL5	4.97e-14	76.3	335	0.099	0.215	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
16	Q9D4T2	6.27e-14	75.5	304	0.110	0.263	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
17	Q9VD52	1.04e-13	77.0	576	0.097	0.123	Q9VD52_DROME LD21931p OS=Drosophila melanogaster OX=7227 GN=CDC40 PE=1 SV=1
18	Q9FND4	1.52e-13	76.3	523	0.101	0.141	WDS_ARATH WD repeat-containing protein WDS homolog OS=Arabidopsis thaliana OX=3702 GN=WDS PE=1 SV=1
19	O94620	2.17e-13	74.3	340	0.099	0.212	CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf17 PE=1 SV=1
20	Q9C1X0	7.02e-13	72.4	297	0.105	0.259	YN55_SCHPO Uncharacterized WD repeat-containing protein C713.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.05 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.29	22.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	0.26	21.7	Neurobeachin beta propeller domain
3	PF00400 WD40	4e-21	86.1	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355958

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301019	0.999	DNA replication factor Cdt1
2	9606.ENSP00000301764	0.999	DNA damage-binding protein 1
3	9606.ENSP00000364589	0.999	Cullin-4A
4	9606.ENSP00000384109	0.998	Cullin-4B
5	9606.ENSP00000368458	0.996	Proliferating cell nuclear antigen
6	9606.ENSP00000393183	0.991	DDB1- and CUL4-associated factor 1
7	9606.ENSP00000209728	0.989	Cell division control protein 6 homolog
8	9606.ENSP00000216225	0.986	E3 ubiquitin-protein ligase RBX1
9	9606.ENSP00000350512	0.976	COP9 signalosome complex subunit 5
10	9606.ENSP00000388648	0.975	Serine/threonine-protein kinase Chk1
11	9606.ENSP00000264389	0.973	COP9 signalosome complex subunit 4
12	9606.ENSP00000256996	0.968	DNA damage-binding protein 2
13	9606.ENSP00000456340	0.966	DET1 homolog
14	9606.ENSP00000304102	0.960	COP9 signalosome complex subunit 6
15	9606.ENSP00000352928	0.954	DET1- and DDB1-associated protein 1
16	9606.ENSP00000376167	0.953	COP9 signalosome complex subunit 1
17	9606.ENSP00000384629	0.952	N-lysine methyltransferase KMT5A
18	9606.ENSP00000299259	0.950	COP9 signalosome complex subunit 2
19	9606.ENSP00000268717	0.949	COP9 signalosome complex subunit 3
20	9606.ENSP00000355506	0.949	Exonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0006974	0.979	cellular response to DNA damage stimulus
GO:0044238	0.977	primary metabolic process
GO:0071704	0.976	organic substance metabolic process
GO:0051726	0.967	regulation of cell cycle
GO:0048519	0.956	negative regulation of biological process
GO:0044237	0.953	cellular metabolic process
GO:0006807	0.936	nitrogen compound metabolic process
GO:0019222	0.931	regulation of metabolic process
GO:0000278	0.928	mitotic cell cycle
GO:1901987	0.926	regulation of cell cycle phase transition
GO:0007346	0.924	regulation of mitotic cell cycle
GO:0000075	0.924	cell cycle checkpoint signaling
GO:0007093	0.914	mitotic cell cycle checkpoint signaling
GO:0048518	0.911	positive regulation of biological process
GO:0080090	0.911	regulation of primary metabolic process
GO:0043170	0.910	macromolecule metabolic process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0051171	0.905	regulation of nitrogen compound metabolic process
GO:0048522	0.876	positive regulation of cellular process
GO:0006281	0.864	DNA repair
GO:1901990	0.843	regulation of mitotic cell cycle phase transition
GO:0009893	0.811	positive regulation of metabolic process
GO:1901564	0.796	organonitrogen compound metabolic process
GO:0051247	0.795	positive regulation of protein metabolic process
GO:0019538	0.781	protein metabolic process
GO:0036211	0.689	protein modification process
GO:1901991	0.681	negative regulation of mitotic cell cycle phase transition
GO:0031570	0.665	DNA integrity checkpoint signaling
GO:0070647	0.649	protein modification by small protein conjugation or removal
GO:0042770	0.646	signal transduction in response to DNA damage
GO:1902749	0.644	regulation of cell cycle G2/M phase transition
GO:0010389	0.634	regulation of G2/M transition of mitotic cell cycle
GO:0000077	0.634	DNA damage checkpoint signaling
GO:0016567	0.604	protein ubiquitination
GO:0006301	0.591	postreplication repair
GO:0071897	0.591	DNA biosynthetic process
GO:0044773	0.591	mitotic DNA damage checkpoint signaling
GO:0042176	0.582	regulation of protein catabolic process
GO:0000731	0.578	DNA synthesis involved in DNA repair
GO:0019985	0.554	translesion synthesis
GO:0010972	0.549	negative regulation of G2/M transition of mitotic cell cycle
GO:0007095	0.543	mitotic G2 DNA damage checkpoint signaling
GO:0009314	0.499	response to radiation
GO:0031323	0.451	regulation of cellular metabolic process
GO:0009896	0.397	positive regulation of catabolic process
GO:0045787	0.304	positive regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0032991	0.978	protein-containing complex
GO:0005730	0.885	nucleolus
GO:1990234	0.878	transferase complex
GO:0140535	0.805	intracellular protein-containing complex
GO:0015630	0.778	microtubule cytoskeleton
GO:0080008	0.415	Cul4-RING E3 ubiquitin ligase complex
GO:0005815	0.379	microtubule organizing center
GO:0005813	0.324	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]