StarFunc result for job id Q9NZJ4

User Input

>input (1400 residues)
METKENRWVPVTVLPGCVGCRTVAALASWTVRDVKERIFAETGFPVSEQRLWRGGRELSD
WIKIGDLTSKNCHLFVNLQSKGLKGGGRFGQTTPPLVDFLKDILRRYPEGGQILKELIQN
AEDAGATEVKFLYDETQYGTETLWSKDMAPYQGPALYVYNNAVFTPEDWHGIQEIARSRK
KDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQTLFGPHESGQCWNLKDDSKEI
SELSDQFAPFVGIFGSTKETFINGNFPGTFFRFPLRLQPSQLSSNLYNKQKVLELFESFR
ADADTVLLFLKSVQDVSLYVREADGTEKLVFRVTSSESKALKHERPNSIKILGTAISNYC
KKTPSNNITCVTYHVNIVLEEESTKDAQKTSWLVCNSVGGRGISSKLDSLADELKFVPII
GIAMPLSSRDDEAKGATSDFSGKAFCFLPLPPGEESSTGLPVHISGFFGLTDNRRSIKWR
ELDQWRDPAALWNEFLVMNVVPKAYATLILDSIKRLEMEKSSDFPLSVDVIYKLWPEASK
VKVHWQPVLEPLFSELLQNAVIYSISCDWVRLEQVYFSELDENLEYTKTVLNYLQSSGKQ
IAKVPGNVDAAVQLTAASGTTPVRKVTPAWVRQVLRKCAHLGCAEEKLHLLEFVLSDQAY
SELLGLELLPLQNGNFVPFSSSVSDQDVIYITSAEYPRSLFPSLEGRFILDNLKPHLVAA
LKEAAQTRGRPCTQLQLLNPERFARLIKEVMNTFWPGRELIVQWYPFDENRNHPSVSWLK
MVWKNLYIHFSEDLTLFDEMPLIPRTILEEGQTCVELIRLRIPSLVILDDESEAQLPEFL
ADIVQKLGGFVLKKLDASIQHPLIKKYIHSPLPSAVLQIMEKMPLQKLCNQITSLLPTHK
DALRKFLASLTDSSEKEKRIIQELAIFKRINHSSDQGISSYTKLKGCKVLHHTAKLPADL
RLSISVIDSSDEATIRLANMLKIEQLKTTSCLKLVLKDIENAFYSHEEVTQLMLWVLENL
SSLKNENPNVLEWLTPLKFIQISQEQMVSAGELFDPDIEVLKDLFCNEEGTYFPPSVFTS
PDILHSLRQIGLKNEASLKEKDVVQVAKKIEALQVGACPDQDVLLKKAKTLLLVLNKNHT
LLQSSEGKMTLKKIKWVPACKERPPNYPGSLVWKGDLCNLCAPPDMCDVGHAILIGSSLP
LVESIHVNLEKALGIFTKPSLSAVLKHFKIVVDWYSSKTFSDEDYYQFQHILLEIYGFMH
DHLNEGKDSFRALKFPWVWTGKKFCPLAQAVIKPIHDLDLQPYLHNVPKTMAKFHQLFKV
CGSIEELTSDHISMVIQKIYLKSDQDLSEQESKQNLHLMLNIIRWLYSNQIPASPNTPVP
IHHSKNPSKLIMKPIHECCY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07901	0.192	0.317	3.851E-11	733	0.065	0.124	P07901.pdb.gz	HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4
2	AFDB:P9WMJ7	0.201	0.359	1.190E-10	647	0.066	0.142	P9WMJ7.pdb.gz	HTPG_MYCTU Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=htpG PE=1 SV=1
3	AFDB:F4JFN3	0.188	0.287	1.447E-10	799	0.068	0.119	F4JFN3.pdb.gz	HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP90-6 PE=1 SV=1
4	AFDB:Q9BLC5	0.192	0.326	1.942E-10	716	0.061	0.119	Q9BLC5.pdb.gz	HSP83_BOMMO Heat shock protein 83 OS=Bombyx mori OX=7091 GN=Hsp83 PE=1 SV=1
5	PDB:5tthA	0.197	0.347	2.066E-10	671	0.064	0.133	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
6	AFDB:Q9VAY2	0.186	0.291	2.250E-10	787	0.071	0.126	Q9VAY2.pdb.gz	Q9VAY2_DROME Heat shock protein 83 OS=Drosophila melanogaster OX=7227 GN=Gp93 PE=1 SV=1
7	AFDB:A0A024RD80	0.192	0.322	2.363E-10	724	0.061	0.119	A0A024RD80.pdb.gz
8	AFDB:Q0Q0I7	0.189	0.323	2.607E-10	700	0.071	0.141	Q0Q0I7.pdb.gz	Q0Q0I7_WHEAT Heat shock protein 90 OS=Triticum aestivum OX=4565 GN=HSP90-2 PE=1 SV=1
9	AFDB:P27323	0.190	0.327	3.020E-10	700	0.069	0.139	P27323.pdb.gz	HS901_ARATH Heat shock protein 90-1 OS=Arabidopsis thaliana OX=3702 GN=HSP90-1 PE=1 SV=3
10	AFDB:Q5XHZ0	0.182	0.306	3.331E-10	706	0.054	0.106	Q5XHZ0.pdb.gz	TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1
11	AFDB:P46598	0.188	0.319	3.859E-10	707	0.063	0.124	P46598.pdb.gz	HSP90_CANAL Heat shock protein 90 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSP90 PE=1 SV=1
12	PDB:7kclB	0.188	0.349	4.755E-10	614	0.047	0.107	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
13	PDB:2iopA	0.104	0.201	2.645E-9	618	0.054	0.121	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
14	PDB:5tthB	0.193	0.349	5.256E-9	621	0.066	0.148	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
15	PDB:5fwkA	0.186	0.347	9.942E-9	638	0.047	0.103	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
16	PDB:2cg9B	0.200	0.370	1.791E-8	618	0.061	0.139	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
17	PDB:7kw7B	0.174	0.317	1.881E-8	628	0.055	0.123	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
18	PDB:1y4uB	0.119	0.289	1.046E-7	454	0.050	0.154	1y4uB.pdb.gz
19	PDB:7p8vA	0.144	0.507	4.356E-5	331	0.032	0.136	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
20	PDB:2zbkB	0.123	0.278	1.719E-4	506	0.039	0.107	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZJ4	0.0	2900	4579	1.000	0.306	SACS_HUMAN Sacsin OS=Homo sapiens OX=9606 GN=SACS PE=1 SV=2
2	Q9FN44	3.23e-83	305	4706	0.254	0.075	Q9FN44_ARATH Zinc finger, C3HC4 type (RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=MYJ24.15 PE=1 SV=1
3	F4JTS8	0.89	36.6	2729	0.031	0.016	NOV_ARATH Protein NO VEIN OS=Arabidopsis thaliana OX=3702 GN=NOV PE=1 SV=1
4	Q54QH4	1.6	35.8	905	0.019	0.029	Q54QH4_DICDI WASP-related protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283827 PE=4 SV=1
5	Q381I7	2.7	35.0	1001	0.021	0.030	Q381I7_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7630 PE=4 SV=1
6	Q54T91	2.9	34.3	317	0.015	0.066	Q54T91_DICDI AB hydrolase-1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281917 PE=4 SV=1
7	P11205	3.6	34.7	2204	0.024	0.015	L_NDVB RNA-directed RNA polymerase L OS=Newcastle disease virus (strain Beaudette C/45) OX=11178 GN=L PE=3 SV=1
8	Q39256	5.9	33.9	631	0.016	0.035	UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana OX=3702 GN=UBQ8 PE=3 SV=1
9	P32608	6.8	33.5	588	0.027	0.065	RTG2_YEAST Retrograde regulation protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTG2 PE=1 SV=2
10	P54725	7.0	33.1	363	0.018	0.069	RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1
11	Q5AZV1	7.0	30.8	81	0.009	0.148	Q5AZV1_EMENI Ubiquitin-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06179 PE=4 SV=1
12	Q38C18	7.4	33.5	784	0.013	0.023	Q38C18_TRYB2 Ubiquitin-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5470 PE=4 SV=1
13	O14399	9.0	30.4	78	0.009	0.154	UBL1_SCHPO Ubiquitin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubl1 PE=3 SV=1
14	Q18411	9.1	33.1	543	0.016	0.042	NTP1_CAEEL Nucleoside-triphosphatase ntp-1 OS=Caenorhabditis elegans OX=6239 GN=ntp-1 PE=1 SV=2
15	Q12181	9.7	33.1	623	0.021	0.048	NDOR1_YEAST NADPH-dependent diflavin oxidoreductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAH18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14287 DUF4368	1.9e+02	13.7	Domain of unknown function (DUF4368)
2	PF09286 Pro-kuma_activ	1.2e+02	14.4	Pro-kumamolisin, activation domain
3	PF00240 ubiquitin	0.0019	29.2	Ubiquitin family
4	PF14560 Ubiquitin_2	4.6e+02	12.7	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000449089	0.899	Dynamin-1-like protein
2	9606.ENSP00000232165	0.764	Ubiquitin-protein ligase E3A
3	9606.ENSP00000309501	0.721	NACHT and WD repeat domain containing 2
4	9606.ENSP00000302961	0.708	Heat shock protein family A member 4
5	9606.ENSP00000467141	0.694	Titin
6	9606.ENSP00000286688	0.684	Protein C8orf37
7	9606.ENSP00000375783	0.681	Dapper homolog 3
8	9606.ENSP00000272444	0.678	RNA/RNP complex-1-interacting phosphatase
9	9606.ENSP00000252934	0.646	Ataxin-10
10	9606.ENSP00000436812	0.646	Mucin-5B
11	9606.ENSP00000298472	0.644	Synaptic vesicular amine transporter
12	9606.ENSP00000256190	0.594	Myotubularin-related protein 13
13	9606.ENSP00000435637	0.589	Contactin-5
14	9606.ENSP00000224140	0.574	Probable helicase senataxin
15	9606.ENSP00000338019	0.573	DnaJ homolog subfamily B member 2
16	9606.ENSP00000364403	0.571	E3 ubiquitin-protein ligase UBR4
17	9606.ENSP00000269143	0.568	AFG3-like protein 2
18	9606.ENSP00000443292	0.568	Protein FAM222A
19	9606.ENSP00000345464	0.565	E3 ubiquitin-protein ligase NHLRC1
20	9606.ENSP00000268704	0.563	Paraplegin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070628	0.999	proteasome binding
GO:0051087	0.999	chaperone binding
GO:0042802	0.999	identical protein binding
GO:0030544	0.999	Hsp70 protein binding
GO:0003824	0.524	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051129	0.938	negative regulation of cellular component organization
GO:0044087	0.937	regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0043005	0.992	neuron projection
GO:0005739	0.991	mitochondrion
GO:0036477	0.985	somatodendritic compartment
GO:0070852	0.983	cell body fiber
GO:0030425	0.976	dendrite
GO:0030424	0.967	axon
GO:0031981	0.350	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]