StarFunc result for job id Q9NZJ5

User Input

>input (1116 residues)
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZJ5	1.000	1.000	0.000	1116	1.000	1.000	Q9NZJ5.pdb.gz	E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3
2	PDB:7qwkH	0.211	0.862	1.357E-14	259	0.095	0.409	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
3	PDB:7qwkE	0.198	0.861	7.541E-14	241	0.085	0.394	7qwkE.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
4	PDB:1unlA	0.195	0.678	3.796E-10	292	0.063	0.240	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
5	PDB:5u6yA	0.193	0.445	8.720E-10	459	0.067	0.163	5u6yA.pdb.gz
6	AFDB:O81472	0.147	0.208	9.630E-10	773	0.111	0.160	O81472.pdb.gz	MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana OX=3702 GN=MEKK2 PE=1 SV=1
7	PDB:2b9iA	0.191	0.589	1.805E-9	338	0.071	0.234	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
8	PDB:4gcjA	0.192	0.653	2.003E-9	304	0.071	0.260	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
9	AFDB:Q96RG2	0.140	0.119	2.100E-9	1323	0.152	0.128	Q96RG2.pdb.gz	PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3
10	PDB:4eomC	0.198	0.727	2.110E-9	276	0.070	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
11	PDB:4c0tA	0.209	0.716	2.466E-9	291	0.060	0.230	4c0tA.pdb.gz
12	PDB:6b1uA	0.201	0.474	2.736E-9	442	0.070	0.176	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	AFDB:Q8CEE6	0.144	0.117	2.868E-9	1383	0.161	0.130	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
14	PDB:6s73A	0.194	0.730	3.368E-9	269	0.072	0.297	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
15	AFDB:G5EB22	0.141	0.148	2.379E-7	1050	0.123	0.130	G5EB22.pdb.gz	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
16	AFDB:Q09815	0.140	0.182	6.386E-7	836	0.099	0.132	Q09815.pdb.gz	PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk5 PE=1 SV=1
17	AFDB:Q10407	0.148	0.148	4.848E-6	1116	0.122	0.122	Q10407.pdb.gz	MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1
18	AFDB:Q9H1R3	0.149	0.264	5.666E-6	596	0.060	0.112	Q9H1R3.pdb.gz	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
19	AFDB:Q5B953	0.142	0.187	6.867E-5	828	0.099	0.134	Q5B953.pdb.gz	Q5B953_EMENI Checkpoint protein kinase, putative (AFU_orthologue AFUA_3G08100) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02927 PE=4 SV=1
20	AFDB:Q10156	0.127	0.197	1.497E-4	690	0.091	0.146	Q10156.pdb.gz	LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lkh1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JI14	0.0	1196	1099	0.583	0.592	B8JI14_DANRE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Danio rerio OX=7955 GN=eif2ak3 PE=1 SV=1
2	Q9NZJ5	0.0	2319	1116	1.000	1.000	E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3
3	Q9Z1Z1	0.0	1912	1108	0.875	0.881	E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus OX=10116 GN=Eif2ak3 PE=1 SV=1
4	Q9Z2B5	0.0	1900	1114	0.873	0.874	E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus OX=10090 GN=Eif2ak3 PE=1 SV=1
5	Q9NIV1	6.14e-89	313	1162	0.212	0.204	E2AK3_DROME Eukaryotic translation initiation factor 2-alpha kinase OS=Drosophila melanogaster OX=7227 GN=PEK PE=1 SV=2
6	Q5NE12	2.54e-37	150	511	0.070	0.153	Q5NE12_DANRE Z-DNA binding protein kinase OS=Danio rerio OX=7955 GN=pkz PE=1 SV=1
7	A9YT50	5.04e-37	152	682	0.072	0.117	A9YT50_DANRE Double-stranded RNA activated protein kinase OS=Danio rerio OX=7955 GN=pkr PE=2 SV=1
8	Q5NE14	2.18e-36	147	511	0.070	0.153	Q5NE14_DANRE Interferon-induced, double-stranded RNA-activated protein kinase OS=Danio rerio OX=7955 GN=zgc:136657 PE=1 SV=1
9	Q0H740	3.81e-36	146	513	0.077	0.168	Q0H740_SALSA DsRNA activated Z-DNA binding protein kinase OS=Salmo salar OX=8030 GN=PKZ PE=2 SV=1
10	Q19192	3.33e-35	148	1077	0.070	0.072	E2AKA_CAEEL Eukaryotic translation initiation factor 2-alpha kinase pek-1 OS=Caenorhabditis elegans OX=6239 GN=pek-1 PE=1 SV=2
11	P19525	2.26e-33	139	551	0.067	0.136	E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens OX=9606 GN=EIF2AK2 PE=1 SV=2
12	P33279	4.11e-32	135	626	0.073	0.129	E2AK1_RABIT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=EIF2AK1 PE=1 SV=1
13	Q63185	6.82e-32	135	620	0.070	0.126	E2AK1_RAT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Rattus norvegicus OX=10116 GN=Eif2ak1 PE=1 SV=2
14	Q9Z2R9	8.70e-32	135	619	0.071	0.128	E2AK1_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Mus musculus OX=10090 GN=Eif2ak1 PE=1 SV=2
15	Q9BQI3	9.24e-32	135	630	0.072	0.127	E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1 PE=1 SV=2
16	Q63184	2.04e-31	132	513	0.069	0.150	E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus OX=10116 GN=Eif2ak2 PE=1 SV=1
17	Q550L8	2.01e-30	133	1358	0.071	0.058	IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum OX=44689 GN=ifkB PE=2 SV=1
18	Q558U1	3.19e-30	132	2258	0.071	0.035	IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum OX=44689 GN=ifkA PE=2 SV=1
19	Q9HGN1	3.39e-30	132	1576	0.071	0.050	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
20	Q03963	1.91e-29	126	515	0.058	0.126	E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus OX=10090 GN=Eif2ak2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	40	14.8	ABC1 atypical kinase-like domain
2	PF01636 APH	66	14.8	Phosphotransferase enzyme family
3	PF06293 Kdo	6.3	17.7	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	2.9	18.8	Kinase-like
5	PF03137 OATP	7e+02	9.8	Organic Anion Transporter Polypeptide (OATP) family
6	PF00069 Pkinase	4.5e-46	169.0	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	3.1e-26	103.8	Protein tyrosine and serine/threonine kinase
8	PF01011 PQQ	5.5e+02	11.8	PQQ enzyme repeat
9	PF13360 PQQ_2	1.1	20.4	PQQ-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307235

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
2	9606.ENSP00000324173	0.999	78 kDa glucose-regulated protein
3	9606.ENSP00000235329	0.972	Mitofusin-2
4	9606.ENSP00000171111	0.958	Kelch-like ECH-associated protein 1
5	9606.ENSP00000336790	0.957	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000380252	0.939	Nuclear factor erythroid 2-related factor 2
7	9606.ENSP00000216037	0.937	X-box-binding protein 1
8	9606.ENSP00000287820	0.926	Peroxisome proliferator-activated receptor gamma
9	9606.ENSP00000356919	0.924	Cyclic AMP-dependent transcription factor ATF-6 alpha
10	9606.ENSP00000364119	0.922	Eukaryotic translation initiation factor 2 subunit 2
11	9606.ENSP00000253039	0.919	Eukaryotic translation initiation factor 2 subunit 3
12	9606.ENSP00000358866	0.911	Filamin-A
13	9606.ENSP00000473631	0.857	DnaJ homolog subfamily C member 3
14	9606.ENSP00000326366	0.854	Presenilin-1
15	9606.ENSP00000360869	0.828	Interferon-induced protein with tetratricopeptide repeats 1
16	9606.ENSP00000448665	0.827	DNA damage-inducible transcript 3 protein
17	9606.ENSP00000360874	0.820	Interferon induced protein with tetratricopeptide repeats 1B
18	9606.ENSP00000355747	0.815	Presenilin-2
19	9606.ENSP00000335153	0.790	Heat shock protein HSP 90-alpha
20	9606.ENSP00000349960	0.774	Actin, cytoplasmic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004694	1.000	eukaryotic translation initiation factor 2alpha kinase activity
GO:0019899	0.990	enzyme binding
GO:0019902	0.935	phosphatase binding
GO:0019903	0.930	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.997	response to stimulus
GO:0008152	0.995	metabolic process
GO:0051716	0.993	cellular response to stimulus
GO:0031323	0.992	regulation of cellular metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0080090	0.991	regulation of primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0036211	0.985	protein modification process
GO:0006468	0.979	protein phosphorylation
GO:0048523	0.975	negative regulation of cellular process
GO:0010468	0.972	regulation of gene expression
GO:0051246	0.972	regulation of protein metabolic process
GO:0007154	0.968	cell communication
GO:0034976	0.959	response to endoplasmic reticulum stress
GO:0007165	0.957	signal transduction
GO:0009892	0.956	negative regulation of metabolic process
GO:0048583	0.955	regulation of response to stimulus
GO:0010558	0.949	negative regulation of macromolecule biosynthetic process
GO:0051248	0.949	negative regulation of protein metabolic process
GO:0042221	0.948	response to chemical
GO:0031327	0.947	negative regulation of cellular biosynthetic process
GO:0006417	0.935	regulation of translation
GO:0043555	0.931	regulation of translation in response to stress
GO:2000113	0.920	negative regulation of cellular macromolecule biosynthetic process
GO:0070887	0.916	cellular response to chemical stimulus
GO:0009605	0.915	response to external stimulus
GO:0048522	0.915	positive regulation of cellular process
GO:0010646	0.912	regulation of cell communication
GO:0051173	0.909	positive regulation of nitrogen compound metabolic process
GO:0017148	0.907	negative regulation of translation
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0010033	0.904	response to organic substance
GO:0010604	0.904	positive regulation of macromolecule metabolic process
GO:0019219	0.897	regulation of nucleobase-containing compound metabolic process
GO:0023051	0.896	regulation of signaling
GO:0071310	0.886	cellular response to organic substance
GO:0009966	0.878	regulation of signal transduction
GO:0006355	0.878	regulation of DNA-templated transcription
GO:1902531	0.873	regulation of intracellular signal transduction
GO:0045935	0.856	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.855	positive regulation of cellular biosynthetic process
GO:0080134	0.853	regulation of response to stress
GO:0042981	0.852	regulation of apoptotic process
GO:0045893	0.849	positive regulation of DNA-templated transcription
GO:0080135	0.844	regulation of cellular response to stress
GO:0006986	0.824	response to unfolded protein
GO:0035967	0.803	cellular response to topologically incorrect protein
GO:0034620	0.793	cellular response to unfolded protein
GO:1905897	0.739	regulation of response to endoplasmic reticulum stress
GO:0030968	0.736	endoplasmic reticulum unfolded protein response
GO:0006984	0.721	ER-nucleus signaling pathway
GO:0046777	0.717	protein autophosphorylation
GO:0006446	0.663	regulation of translational initiation
GO:0032501	0.624	multicellular organismal process
GO:0006356	0.595	regulation of transcription by RNA polymerase I
GO:0032502	0.594	developmental process
GO:0051239	0.593	regulation of multicellular organismal process
GO:0045943	0.577	positive regulation of transcription by RNA polymerase I
GO:0071496	0.555	cellular response to external stimulus
GO:0031667	0.541	response to nutrient levels
GO:0042594	0.533	response to starvation
GO:0048856	0.505	anatomical structure development
GO:0009267	0.498	cellular response to starvation
GO:0048584	0.465	positive regulation of response to stimulus
GO:0010628	0.384	positive regulation of gene expression
GO:0065009	0.372	regulation of molecular function
GO:0051247	0.307	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031090	0.994	organelle membrane
GO:0005829	0.993	cytosol
GO:0005783	0.990	endoplasmic reticulum
GO:0031984	0.971	organelle subcompartment
GO:0042175	0.955	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.953	endoplasmic reticulum membrane
GO:0032991	0.909	protein-containing complex
GO:0005634	0.649	nucleus
GO:0031974	0.606	membrane-enclosed lumen
GO:0070013	0.597	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]