StarFunc result for job id Q9NZJ6

User Input

>input (369 residues)
MWSGRKLGSSGGWFLRVLGPGGCNTKAARPLISSAVYVKNQLSGTLQIKPGVFNEYRTIW
FKSYRTIFSCLNRIKSFRYPWARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSM
NDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPVDEN
IKTAQCHKSFDPVLDKRIEYRVCSLEEIVEETAETFDAVVASEVVEHVIDLETFLQCCCQ
VLKPGGSLFITTINKTQLSYALGIVFSEQIASIVPKGTHTWEKFVSPETLESILESNGLS
VQTVVGMLYNPFSGYWHWSENTSLNYAAYAVKSRVQEHPASAEFVLKGETEELQANACTN
PAVHEKLKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZJ6	1.000	1.000	5.674E-74	369	1.000	1.000	Q9NZJ6.pdb.gz	COQ3_HUMAN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3
2	AFDB:Q8BMS4	0.726	0.724	8.720E-57	370	0.726	0.724	Q8BMS4.pdb.gz	COQ3_MOUSE Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Coq3 PE=1 SV=1
3	AFDB:Q63159	0.715	0.763	6.186E-55	345	0.691	0.739	Q63159.pdb.gz	COQ3_RAT Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Coq3 PE=2 SV=2
4	AFDB:O49354	0.649	0.740	1.718E-33	322	0.306	0.351	O49354.pdb.gz	COQ3_ARATH Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ3 PE=1 SV=2
5	AFDB:Q5BIB9	0.653	0.807	2.108E-31	297	0.287	0.357	Q5BIB9.pdb.gz	Q5BIB9_DROME RE17490p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=2 SV=1
6	AFDB:Q9VIF3	0.648	0.768	1.309E-30	310	0.298	0.355	Q9VIF3.pdb.gz	Q9VIF3_DROME Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=3 SV=3
7	AFDB:O18235	0.621	0.847	9.872E-29	268	0.279	0.384	O18235.pdb.gz	O18235_CAEEL Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-3 PE=1 SV=1
8	AFDB:P17993	0.591	0.893	6.133E-28	240	0.220	0.338	P17993.pdb.gz	UBIG_ECOLI Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ubiG PE=1 SV=1
9	AFDB:O74421	0.613	0.818	5.222E-26	274	0.249	0.336	O74421.pdb.gz	COQ3_SCHPO Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq3 PE=3 SV=2
10	AFDB:Q38DV8	0.612	0.774	1.597E-23	288	0.236	0.302	Q38DV8.pdb.gz	Q38DV8_TRYB2 Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1960 PE=3 SV=1
11	PDB:4kdcA	0.511	0.845	4.263E-23	217	0.198	0.336	4kdcA.pdb.gz
12	PDB:5m58A	0.439	0.662	5.431E-12	230	0.089	0.143	5m58A.pdb.gz	Crystal Structure and Catalytic Mechanism of CouO, a Versatile C-Methyltransferase from Streptomyces rishiriensis.
13	PDB:5mgzA	0.435	0.656	2.811E-11	230	0.100	0.161	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
14	PDB:7l9uA	0.366	0.466	1.009E-10	282	0.100	0.131	7l9uA.pdb.gz
15	PDB:7ezgA	0.415	0.538	1.073E-10	275	0.125	0.167	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
16	PDB:4qnxB	0.386	0.437	1.454E-10	322	0.133	0.152	4qnxB.pdb.gz
17	PDB:5f8cB	0.391	0.397	2.096E-10	363	0.127	0.129	5f8cB.pdb.gz
18	PDB:5wp5A	0.363	0.299	3.853E-10	463	0.095	0.076	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
19	PDB:1nbhA	0.405	0.497	4.352E-10	292	0.141	0.178	1nbhA.pdb.gz	Catalytic mechanism of glycine N-methyltransferase
20	PDB:3lccA	0.371	0.599	5.552E-10	216	0.098	0.167	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63159	0.0	519	345	0.694	0.742	COQ3_RAT Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Coq3 PE=2 SV=2
2	Q8BMS4	0.0	544	370	0.726	0.724	COQ3_MOUSE Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Coq3 PE=1 SV=1
3	Q9NZJ6	0.0	766	369	1.000	1.000	COQ3_HUMAN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3
4	O49354	1.73e-64	209	322	0.271	0.311	COQ3_ARATH Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COQ3 PE=1 SV=2
5	E1JHN2	1.83e-59	196	289	0.287	0.367	E1JHN2_DROME Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=3 SV=1
6	Q5BIB9	2.95e-59	195	297	0.287	0.357	Q5BIB9_DROME RE17490p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=2 SV=1
7	O18235	9.30e-57	188	268	0.271	0.373	O18235_CAEEL Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-3 PE=1 SV=1
8	Q9VIF3	1.19e-56	189	310	0.295	0.352	Q9VIF3_DROME Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=3 SV=3
9	Q95R84	7.32e-51	172	252	0.271	0.397	Q95R84_DROME SD02225p OS=Drosophila melanogaster OX=7227 GN=Coq3 PE=2 SV=1
10	P17993	3.97e-45	157	240	0.217	0.333	UBIG_ECOLI Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=ubiG PE=1 SV=1
11	O74421	4.05e-44	155	274	0.249	0.336	COQ3_SCHPO Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq3 PE=3 SV=2
12	Q38DV8	2.09e-39	143	288	0.230	0.295	Q38DV8_TRYB2 Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1960 PE=3 SV=1
13	P27680	3.98e-28	114	312	0.220	0.260	COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ3 PE=1 SV=2
14	P9WK03	1.00e-06	51.2	197	0.114	0.213	Y089_MYCTU Uncharacterized methyltransferase Rv0089 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0089 PE=3 SV=1
15	O74198	4.23e-05	47.4	376	0.095	0.093	ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERG6 PE=1 SV=2
16	Q22993	4.37e-05	47.8	437	0.100	0.085	PMT2_CAEEL Phosphoethanolamine N-methyltransferase 2 OS=Caenorhabditis elegans OX=6239 GN=pmt-2 PE=1 SV=1
17	P38892	8.46e-05	46.2	291	0.076	0.096	CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRG1 PE=1 SV=1
18	E5KIC0	1.07e-04	45.4	245	0.092	0.139	CYPM_STRSQ Cypemycin N-terminal methyltransferase OS=Streptomyces sp. OX=1931 GN=cypM PE=1 SV=1
19	A0A482NB13	1.13e-04	45.8	292	0.087	0.110	ICCD_TALVA S-adenosyl-L-methionine-dependent Diels-Alderase iccD OS=Talaromyces variabilis OX=28576 GN=iccD PE=1 SV=1
20	Q726V4	1.77e-04	45.4	382	0.117	0.113	Q726V4_DESVH Conserved domain protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3002 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00107 ADH_zinc_N	72	14.8	Zinc-binding dehydrogenase
2	PF02353 CMAS	1.4e-06	39.4	Mycolic acid cyclopropane synthetase
3	PF08241 Methyltransf_11	4.2e-18	77.1	Methyltransferase domain
4	PF08242 Methyltransf_12	5.8e-10	51.1	Methyltransferase domain
5	PF09445 Methyltransf_15	46	15.0	RNA cap guanine-N2 methyltransferase
6	PF13489 Methyltransf_23	1.6e-18	78.6	Methyltransferase domain
7	PF13649 Methyltransf_25	7.5e-13	60.3	Methyltransferase domain
8	PF13847 Methyltransf_31	2.1e-09	48.8	Methyltransferase domain
9	PF13679 Methyltransf_32	2.8e+02	12.9	Methyltransferase domain
10	PF05148 Methyltransf_8	1.1e+02	14.1	Hypothetical methyltransferase
11	PF08003 Methyltransf_9	0.23	22.0	Protein of unknown function (DUF1698)
12	PF05891 Methyltransf_PK	3.5	18.6	AdoMet dependent proline di-methyltransferase
13	PF05175 MTS	0.088	23.9	Methyltransferase small domain
14	PF05401 NodS	4.5	18.6	Nodulation protein S (NodS)
15	PF03291 Pox_MCEL	29	15.2	mRNA capping enzyme
16	PF06325 PrmA	0.088	23.8	Ribosomal protein L11 methyltransferase (PrmA)
17	PF01209 Ubie_methyltran	0.00065	30.7	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333946	0.999	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
2	9606.ENSP00000322316	0.997	5-demethoxyubiquinone hydroxylase, mitochondrial
3	9606.ENSP00000262507	0.992	Ubiquinone biosynthesis protein COQ9, mitochondrial
4	9606.ENSP00000288532	0.990	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
5	9606.ENSP00000300452	0.989	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
6	9606.ENSP00000310873	0.963	4-hydroxybenzoate polyprenyltransferase, mitochondrial
7	9606.ENSP00000355741	0.956	Atypical kinase COQ8A, mitochondrial
8	9606.ENSP00000365388	0.942	Decaprenyl-diphosphate synthase subunit 1
9	9606.ENSP00000315118	0.938	Atypical kinase COQ8B, mitochondrial
10	9606.ENSP00000358033	0.869	Decaprenyl-diphosphate synthase subunit 2
11	9606.ENSP00000238561	0.803	Uncharacterized aarF domain-containing protein kinase 1
12	9606.ENSP00000072869	0.770	Uncharacterized aarF domain-containing protein kinase 2
13	9606.ENSP00000273075	0.702	Aspartyl aminopeptidase
14	9606.ENSP00000426638	0.697	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
15	9606.ENSP00000310547	0.689	Uncharacterized aarF domain-containing protein kinase 5
16	9606.ENSP00000312587	0.667	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
17	9606.ENSP00000306397	0.656	Cytochrome b-c1 complex subunit Rieske, mitochondrial
18	9606.ENSP00000377311	0.654	Ferredoxin-2, mitochondrial
19	9606.ENSP00000282841	0.647	Geranylgeranyl pyrophosphate synthase
20	9606.ENSP00000263960	0.643	Coenzyme Q-binding protein COQ10 homolog B, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008171	0.999	O-methyltransferase activity
GO:0010420	0.712	3,4-dihydroxy-5-polyprenylbenzoic acid O-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.997	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:1901576	0.981	organic substance biosynthetic process
GO:0044249	0.980	cellular biosynthetic process
GO:0006744	0.970	ubiquinone biosynthetic process
GO:0019400	0.716	alditol metabolic process
GO:0006071	0.694	glycerol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0016020	0.975	membrane
GO:0032991	0.967	protein-containing complex
GO:0005740	0.936	mitochondrial envelope
GO:0031090	0.935	organelle membrane
GO:0019866	0.868	organelle inner membrane
GO:0031966	0.773	mitochondrial membrane
GO:0005743	0.746	mitochondrial inner membrane
GO:0005759	0.725	mitochondrial matrix
GO:0005634	0.657	nucleus
GO:0031981	0.567	nuclear lumen
GO:0098798	0.386	mitochondrial protein-containing complex
GO:0005654	0.342	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.
RHEA:44452	0.712	3,4-dihydroxy-5-all-trans-polyprenylbenzoate + S-adenosyl-L-methionine = 3-methoxy,4-hydroxy-5-all-trans-polyprenylbenzoate + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.114	0.712	polyprenyldihydroxybenzoate methyltransferase.

[back to server]