StarFunc result for job id Q9NZJ7

User Input

>input (389 residues)
MGASDPEVAPWARGGAAGMAGAGAGAGARGGAAAGVEARARDPPPAHRAHPRHPRPAAQP
SARRMDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN
VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ
VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI
GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG
SQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW
KYLSVQGQLFRGSSLLFRRVSSGSCFALE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q791T5	0.801	0.801	2.278E-49	389	0.982	0.982	Q791T5.pdb.gz	MTCH1_MOUSE Mitochondrial carrier homolog 1 OS=Mus musculus OX=10090 GN=Mtch1 PE=1 SV=1
2	AFDB:Q9PUL9	0.699	0.900	1.694E-25	300	0.378	0.490	Q9PUL9.pdb.gz	Q9PUL9_DANRE Mitochondrial carrier homolog 2 OS=Danio rerio OX=7955 GN=fi20c06 PE=1 SV=1
3	AFDB:Q791V5	0.690	0.880	3.219E-25	303	0.380	0.488	Q791V5.pdb.gz	MTCH2_MOUSE Mitochondrial carrier homolog 2 OS=Mus musculus OX=10090 GN=Mtch2 PE=1 SV=1
4	AFDB:Q6I583	0.535	0.580	7.469E-9	355	0.141	0.155	Q6I583.pdb.gz	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
5	AFDB:Q9BSK2	0.510	0.604	1.868E-8	321	0.144	0.174	Q9BSK2.pdb.gz	S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens OX=9606 GN=SLC25A33 PE=1 SV=1
6	AFDB:Q84UC7	0.509	0.617	2.350E-8	311	0.123	0.154	Q84UC7.pdb.gz	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
7	AFDB:Q9M024	0.485	0.458	3.094E-8	415	0.162	0.152	Q9M024.pdb.gz	TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TAAC PE=1 SV=1
8	AFDB:Q59TD1	0.533	0.521	1.169E-7	399	0.149	0.145	Q59TD1.pdb.gz	Q59TD1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM2 PE=3 SV=1
9	AFDB:P04710	0.493	0.604	1.341E-7	309	0.147	0.184	P04710.pdb.gz	ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAC1 PE=1 SV=1
10	AFDB:Q09188	0.530	0.625	1.936E-7	322	0.123	0.149	Q09188.pdb.gz	ADT_SCHPO ADP,ATP carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anc1 PE=1 SV=1
11	PDB:4c9qB	0.476	0.617	4.674E-7	290	0.141	0.190	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.509	0.653	6.745E-7	293	0.139	0.184	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.390	0.482	1.492E-3	292	0.131	0.175	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:4b2ta	0.105	0.109	1.755E-1	359	0.121	0.131	4b2ta.pdb.gz
15	PDB:4b2tq	0.093	0.098	3.043E-1	359	0.108	0.117	4b2tq.pdb.gz
16	PDB:5xszA	0.143	0.129	5.038E-1	448	0.075	0.065	5xszA.pdb.gz
17	PDB:6zpoa	0.165	0.243	6.336E-1	226	0.072	0.124	6zpoa.pdb.gz	Structure of the dimeric ATP synthase from bovine mitochondria.
18	PDB:5yqzR	0.118	0.092	7.968E-1	558	0.118	0.082	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.
19	PDB:6zfzA	0.090	0.084	7.968E-1	446	0.080	0.070	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
20	PDB:7d3sR	0.128	0.157	9.143E-1	266	0.093	0.135	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q791T5	0.0	778	389	0.982	0.982	MTCH1_MOUSE Mitochondrial carrier homolog 1 OS=Mus musculus OX=10090 GN=Mtch1 PE=1 SV=1
2	Q9NZJ7	0.0	795	389	1.000	1.000	MTCH1_HUMAN Mitochondrial carrier homolog 1 OS=Homo sapiens OX=9606 GN=MTCH1 PE=1 SV=1
3	Q9PUL9	5.26e-110	326	300	0.393	0.510	Q9PUL9_DANRE Mitochondrial carrier homolog 2 OS=Danio rerio OX=7955 GN=fi20c06 PE=1 SV=1
4	Q791V5	2.31e-102	306	303	0.378	0.485	MTCH2_MOUSE Mitochondrial carrier homolog 2 OS=Mus musculus OX=10090 GN=Mtch2 PE=1 SV=1
5	Q9Y6C9	2.18e-99	299	303	0.370	0.475	MTCH2_HUMAN Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1
6	Q8RXZ9	1.59e-05	48.9	335	0.118	0.137	TDPC1_ARATH Mitochondrial thiamine diphosphate carrier 1 OS=Arabidopsis thaliana OX=3702 GN=At3g21390 PE=2 SV=1
7	Q8BMG8	2.25e-05	48.1	316	0.087	0.108	S2532_MOUSE Solute carrier family 25 member 32 OS=Mus musculus OX=10090 GN=Slc25a32 PE=1 SV=1
8	Q6IZB5	5.03e-05	47.0	316	0.085	0.104	S2532_CRIGR Solute carrier family 25 member 32 OS=Cricetulus griseus OX=10029 GN=SLC25A32 PE=1 SV=1
9	P38127	6.18e-05	47.0	377	0.093	0.095	RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM2 PE=1 SV=1
10	Q6NUK1	1.06e-04	46.6	477	0.103	0.084	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
11	Q382A1	1.08e-04	46.2	339	0.098	0.112	Q382A1_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5960 PE=3 SV=1
12	Q9FI73	1.08e-04	46.2	339	0.075	0.086	TDPC2_ARATH Mitochondrial thiamine diphosphate carrier 2 OS=Arabidopsis thaliana OX=3702 GN=At5g48970 PE=2 SV=1
13	Q8C0K5	1.61e-04	45.8	332	0.167	0.196	GDC_MOUSE Solute carrier family 25 member 16 OS=Mus musculus OX=10090 GN=Slc25a16 PE=1 SV=1
14	Q382J3	1.94e-04	45.4	316	0.085	0.104	Q382J3_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5040 PE=3 SV=1
15	Q9M038	4.84e-04	43.9	309	0.090	0.113	SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=SFC1 PE=2 SV=1
16	Q9H2D1	8.96e-04	43.1	315	0.080	0.098	S2532_HUMAN Solute carrier family 25 member 32 OS=Homo sapiens OX=9606 GN=SLC25A32 PE=1 SV=2
17	Q59TD1	0.001	42.7	399	0.118	0.115	Q59TD1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM2 PE=3 SV=1
18	O13660	0.002	42.0	277	0.113	0.159	YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi069 PE=3 SV=1
19	O22261	0.002	42.0	312	0.093	0.115	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
20	Q8BMD8	0.002	42.7	475	0.067	0.055	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	6.1e-10	50.2	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326366	0.930	Presenilin-1
2	9606.ENSP00000215565	0.787	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000392709	0.778	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
4	9606.ENSP00000418803	0.763	Complex I assembly factor TIMMDC1, mitochondrial
5	9606.ENSP00000358737	0.748	ATP synthase F(0) complex subunit B1, mitochondrial
6	9606.ENSP00000333837	0.716	39S ribosomal protein L12, mitochondrial
7	9606.ENSP00000215375	0.661	ATP synthase subunit delta, mitochondrial
8	9606.ENSP00000362060	0.624	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
9	9606.ENSP00000418842	0.619	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
10	9606.ENSP00000461324	0.588	Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane
11	9606.ENSP00000263383	0.572	Acetolactate synthase-like protein
12	9606.ENSP00000216034	0.541	Mitochondrial import receptor subunit TOM22 homolog
13	9606.ENSP00000355747	0.537	Presenilin-2
14	9606.ENSP00000290949	0.523	V-type proton ATPase subunit d 1
15	9606.ENSP00000376732	0.521	Mitochondrial ribosomal protein S33
16	9606.ENSP00000228318	0.517	Phosphate carrier protein, mitochondrial
17	9606.ENSP00000425759	0.509	Cytochrome c oxidase subunit 7C, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0022857	0.997	transmembrane transporter activity
GO:0008514	0.683	organic anion transmembrane transporter activity
GO:0022804	0.320	active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.959	regulation of cellular process
GO:0051246	0.927	regulation of protein metabolic process
GO:0051173	0.897	positive regulation of nitrogen compound metabolic process
GO:0043085	0.870	positive regulation of catalytic activity
GO:0051247	0.866	positive regulation of protein metabolic process
GO:0045862	0.864	positive regulation of proteolysis
GO:0009987	0.863	cellular process
GO:2000116	0.858	regulation of cysteine-type endopeptidase activity
GO:0043281	0.853	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010950	0.833	positive regulation of endopeptidase activity
GO:0048522	0.830	positive regulation of cellular process
GO:0010941	0.829	regulation of cell death
GO:2001056	0.818	positive regulation of cysteine-type endopeptidase activity
GO:0006919	0.804	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043067	0.681	regulation of programmed cell death
GO:0010942	0.676	positive regulation of cell death
GO:0042981	0.405	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0043233	0.475	organelle lumen
GO:0070013	0.474	intracellular organelle lumen
GO:0032991	0.415	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]