StarFunc result for job id Q9NZL4

User Input

>input (359 residues)
MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEP
DPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQER
EGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQ
EQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQ
QQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLV
TDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZL4	1.000	1.000	1.853E-44	359	1.000	1.000	Q9NZL4.pdb.gz	HPBP1_HUMAN Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 PE=1 SV=2
2	AFDB:Q9LZL7	0.665	0.732	4.249E-11	324	0.234	0.259	Q9LZL7.pdb.gz	Q9LZL7_ARATH Fes1C OS=Arabidopsis thaliana OX=3702 GN=FES1C PE=1 SV=1
3	AFDB:Q84J81	0.671	0.664	1.027E-10	363	0.223	0.220	Q84J81.pdb.gz	Q84J81_ARATH Fes1A OS=Arabidopsis thaliana OX=3702 GN=FES1A PE=1 SV=1
4	AFDB:Q9SV06	0.632	0.597	2.482E-10	382	0.228	0.215	Q9SV06.pdb.gz	Q9SV06_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F4F15.90 PE=1 SV=1
5	AFDB:A0A0G2KDW7	0.623	0.494	1.333E-9	463	0.178	0.138	A0A0G2KDW7.pdb.gz	A0A0G2KDW7_DANRE Nucleotide exchange factor SIL1 OS=Danio rerio OX=7955 GN=si:ch211-195b11.7 PE=4 SV=1
6	AFDB:P38260	0.589	0.713	2.746E-8	290	0.187	0.231	P38260.pdb.gz	FES1_YEAST Hsp70 nucleotide exchange factor FES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FES1 PE=1 SV=1
7	AFDB:O43030	0.549	0.674	3.844E-8	287	0.159	0.199	O43030.pdb.gz	FES1_SCHPO Hsp70 nucleotide exchange factor fes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fes1 PE=1 SV=1
8	AFDB:Q9EPK6	0.602	0.474	4.946E-8	465	0.195	0.151	Q9EPK6.pdb.gz	SIL1_MOUSE Nucleotide exchange factor SIL1 OS=Mus musculus OX=10090 GN=Sil1 PE=1 SV=2
9	AFDB:B7U179	0.590	0.308	8.541E-8	737	0.173	0.084	B7U179.pdb.gz	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
10	AFDB:Q9H173	0.599	0.477	1.146E-7	461	0.214	0.167	Q9H173.pdb.gz	SIL1_HUMAN Nucleotide exchange factor SIL1 OS=Homo sapiens OX=9606 GN=SIL1 PE=1 SV=1
11	PDB:4tnmA	0.496	0.443	1.356E-6	407	0.111	0.098	4tnmA.pdb.gz
12	PDB:1wa5B	0.593	0.467	2.889E-6	466	0.120	0.092	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:5tbkA	0.542	0.473	3.717E-6	417	0.097	0.084	5tbkA.pdb.gz
14	PDB:2z6gA	0.503	0.345	9.370E-6	550	0.139	0.091	2z6gA.pdb.gz
15	PDB:7anwA	0.509	0.302	1.156E-5	645	0.123	0.068	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
16	PDB:6kbnC	0.508	0.374	2.171E-5	504	0.100	0.071	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
17	PDB:3tpoA	0.577	0.481	2.463E-5	438	0.125	0.103	3tpoA.pdb.gz
18	PDB:7rroH7	0.530	0.345	2.794E-5	580	0.131	0.081	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:7cm7A	0.496	0.305	5.248E-5	620	0.111	0.065	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
20	PDB:6bcuW	0.442	0.171	6.475E-5	1052	0.103	0.035	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZL4	0.0	718	359	1.000	1.000	HPBP1_HUMAN Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 PE=1 SV=2
2	Q84J81	1.52e-19	90.9	363	0.226	0.223	Q84J81_ARATH Fes1A OS=Arabidopsis thaliana OX=3702 GN=FES1A PE=1 SV=1
3	Q9LZL7	9.49e-17	82.4	324	0.237	0.262	Q9LZL7_ARATH Fes1C OS=Arabidopsis thaliana OX=3702 GN=FES1C PE=1 SV=1
4	Q9SV06	7.46e-14	74.3	382	0.195	0.183	Q9SV06_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F4F15.90 PE=1 SV=1
5	A0A0G2KDW7	1.40e-07	55.5	463	0.120	0.093	A0A0G2KDW7_DANRE Nucleotide exchange factor SIL1 OS=Danio rerio OX=7955 GN=si:ch211-195b11.7 PE=4 SV=1
6	Q9H173	7.60e-07	53.1	461	0.117	0.091	SIL1_HUMAN Nucleotide exchange factor SIL1 OS=Homo sapiens OX=9606 GN=SIL1 PE=1 SV=1
7	Q9EPK6	3.88e-06	50.8	465	0.117	0.090	SIL1_MOUSE Nucleotide exchange factor SIL1 OS=Mus musculus OX=10090 GN=Sil1 PE=1 SV=2
8	P38260	2.49e-05	47.8	290	0.114	0.141	FES1_YEAST Hsp70 nucleotide exchange factor FES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FES1 PE=1 SV=1
9	O43030	1.04e-04	45.8	287	0.103	0.129	FES1_SCHPO Hsp70 nucleotide exchange factor fes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fes1 PE=1 SV=1
10	O76521	0.009	40.4	543	0.097	0.064	O76521_DROME Importin subunit alpha OS=Drosophila melanogaster OX=7227 GN=Kap-alpha1 PE=2 SV=1
11	Q5U119	0.016	39.3	331	0.097	0.106	Q5U119_DROME LP05312p OS=Drosophila melanogaster OX=7227 GN=Kap-alpha1 PE=2 SV=1
12	Q06680	0.058	38.1	1035	0.067	0.023	CND3_YEAST Condensin complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCG1 PE=1 SV=2
13	Q9U1H6	0.077	37.4	542	0.097	0.065	Q9U1H6_DROME Importin subunit alpha OS=Drosophila melanogaster OX=7227 GN=Kap-alpha1 PE=3 SV=1
14	G5EGJ5	0.48	35.0	767	0.084	0.039	IDA1_CAEEL Receptor-type tyrosine-protein phosphatase-like ida-1 OS=Caenorhabditis elegans OX=6239 GN=ida-1 PE=1 SV=1
15	Q384N3	0.90	33.1	173	0.058	0.121	Q384N3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5725 PE=4 SV=1
16	Q9JL04	1.9	33.1	1578	0.081	0.018	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
17	Q9NZ56	3.2	32.3	1722	0.103	0.021	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
18	Q10429	3.3	32.3	875	0.070	0.029	CND3_SCHPO Condensin complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd3 PE=1 SV=1
19	F4HU83	3.6	32.3	915	0.117	0.046	F4HU83_ARATH Kinesin-like protein OS=Arabidopsis thaliana OX=3702 GN=ARK2 PE=1 SV=1
20	A6P4B8	6.9	31.6	5076	0.067	0.005	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	0.16	23.3	Armadillo/beta-catenin-like repeat
2	PF08609 Fes1	8.4e-06	37.9	Nucleotide exchange factor Fes1
3	PF13513 HEAT_EZ	6.5e+02	12.3	HEAT-like repeat
4	PF04078 Rcd1	62	14.3	Cell differentiation family, Rcd1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.996	Heat shock protein family A member 4
2	9606.ENSP00000364802	0.985	Heat shock 70 kDa protein 1A
3	9606.ENSP00000432083	0.975	Heat shock cognate 71 kDa protein
4	9606.ENSP00000364801	0.951	Heat shock protein family A member 1B
5	9606.ENSP00000420514	0.948	BAG family molecular chaperone regulator 1
6	9606.ENSP00000359727	0.947	BAG family molecular chaperone regulator 2
7	9606.ENSP00000318687	0.943	Heat shock protein 105 kDa
8	9606.ENSP00000335153	0.916	Heat shock protein HSP 90-alpha
9	9606.ENSP00000296464	0.911	Heat shock 70 kDa protein 4L
10	9606.ENSP00000219548	0.905	E3 ubiquitin-protein ligase CHIP
11	9606.ENSP00000435370	0.892	Ubiquitin-like protein FUBI
12	9606.ENSP00000216479	0.865	Activator of 90 kDa heat shock protein ATPase homolog 1
13	9606.ENSP00000351646	0.841	Stress-induced-phosphoprotein 1
14	9606.ENSP00000324173	0.834	78 kDa glucose-regulated protein
15	9606.ENSP00000378199	0.825	Heat shock-related 70 kDa protein 2
16	9606.ENSP00000360850	0.801	Mitochondrial ribosomal protein S2
17	9606.ENSP00000431512	0.788	Heat shock factor protein 1
18	9606.ENSP00000294053	0.787	Caseinolytic peptidase B protein homolog
19	9606.ENSP00000398882	0.787	Deoxyhypusine hydroxylase
20	9606.ENSP00000259469	0.782	60S ribosomal protein L35

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.999	ubiquitin protein ligase binding
GO:0004857	0.998	enzyme inhibitor activity
GO:0003824	0.336	catalytic activity
GO:0097159	0.324	organic cyclic compound binding
GO:1901363	0.318	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:2000058	0.984	regulation of ubiquitin-dependent protein catabolic process
GO:0045862	0.981	positive regulation of proteolysis
GO:0042176	0.977	regulation of protein catabolic process
GO:0031396	0.975	regulation of protein ubiquitination
GO:0006457	0.973	protein folding
GO:0032434	0.973	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:1901800	0.972	positive regulation of proteasomal protein catabolic process
GO:2000060	0.971	positive regulation of ubiquitin-dependent protein catabolic process
GO:1903322	0.968	positive regulation of protein modification by small protein conjugation or removal
GO:0032436	0.939	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0031398	0.923	positive regulation of protein ubiquitination
GO:0071704	0.394	organic substance metabolic process
GO:0044238	0.347	primary metabolic process
GO:0006807	0.334	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.995	nucleus
GO:0005654	0.988	nucleoplasm
GO:0032991	0.954	protein-containing complex
GO:0043232	0.866	intracellular non-membrane-bounded organelle
GO:0012505	0.828	endomembrane system
GO:0005576	0.590	extracellular region
GO:0031982	0.565	vesicle
GO:0005615	0.561	extracellular space
GO:0016020	0.366	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]