StarFunc result for job id Q9NZL9

User Input

>input (334 residues)
MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGF
RRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNL
AKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVL
RIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRML
DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKL
ETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99LB6	0.954	0.954	1.033E-71	334	0.943	0.943	Q99LB6.pdb.gz	MAT2B_MOUSE Methionine adenosyltransferase 2 subunit beta OS=Mus musculus OX=10090 GN=Mat2b PE=1 SV=1
2	PDB:2ydxA	0.911	0.975	1.778E-62	312	0.919	0.984	2ydxA.pdb.gz	Insight Into S-Adenosylmethionine Biosynthesis from the Crystal Structures of the Human Methionine Adenosyltransferase Catalytic and Regulatory Subunits.
3	PDB:2ydyA	0.772	0.990	7.512E-51	260	0.775	0.996	2ydyA.pdb.gz
4	PDB:4kttF	0.791	0.940	3.426E-47	280	0.832	0.993	4kttF.pdb.gz	Structure and function study of the complex that synthesizes S-adenosylmethionine.
5	AFDB:A0QTF8	0.745	0.760	5.144E-24	327	0.240	0.245	A0QTF8.pdb.gz	RMLD_MYCS2 dTDP-4-dehydrorhamnose reductase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rmlD PE=1 SV=1
6	AFDB:Q9L9E9	0.772	0.888	2.432E-23	288	0.225	0.260	Q9L9E9.pdb.gz	NOVS_STRNV dTDP-4-keto-6-deoxy-D-glucose reductase OS=Streptomyces niveus OX=193462 GN=novS PE=3 SV=1
7	AFDB:P37760	0.776	0.861	2.219E-22	299	0.219	0.244	P37760.pdb.gz	RMLD_ECOLI dTDP-4-dehydrorhamnose reductase OS=Escherichia coli (strain K12) OX=83333 GN=rfbD PE=3 SV=2
8	AFDB:O95455	0.726	0.696	9.885E-22	350	0.192	0.183	O95455.pdb.gz	TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens OX=9606 GN=TGDS PE=1 SV=1
9	PDB:1kc1A	0.771	0.859	1.493E-21	298	0.222	0.248	1kc1A.pdb.gz	Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
10	AFDB:P26392	0.769	0.854	1.594E-21	299	0.219	0.244	P26392.pdb.gz	RMLD_SALTY dTDP-4-dehydrorhamnose reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbD PE=1 SV=1
11	AFDB:P9WH09	0.749	0.819	3.266E-21	304	0.231	0.253	P9WH09.pdb.gz	RMLD_MYCTU dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rmlD PE=1 SV=1
12	AFDB:Q9SYM5	0.737	0.384	2.644E-20	669	0.171	0.085	Q9SYM5.pdb.gz	RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana OX=3702 GN=RHM1 PE=1 SV=1
13	PDB:6lttA	0.743	0.795	3.762E-20	311	0.192	0.206	6lttA.pdb.gz
14	AFDB:P37759	0.720	0.670	4.265E-20	361	0.201	0.186	P37759.pdb.gz	RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfbB PE=3 SV=2
15	AFDB:Q20697	0.699	0.684	5.102E-20	342	0.177	0.173	Q20697.pdb.gz	Q20697_CAEEL NAD(P)-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bus-5 PE=1 SV=1
16	PDB:1keuA	0.700	0.651	3.132E-18	361	0.201	0.186	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
17	PDB:6vo6D	0.742	0.792	8.147E-18	311	0.165	0.177	6vo6D.pdb.gz	Structural Analysis of Cj1427, an Essential NAD-Dependent Dehydrogenase for the Biosynthesis of the Heptose Residues in the Capsular Polysaccharides ofCampylobacter jejuni.
18	PDB:4bkpC	0.690	0.705	1.772E-17	326	0.195	0.199	4bkpC.pdb.gz	Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp
19	PDB:1i3kA	0.706	0.682	2.692E-17	347	0.186	0.179	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
20	PDB:1n7gB	0.742	0.738	2.692E-17	336	0.147	0.146	1n7gB.pdb.gz	The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99LB6	0.0	671	334	0.943	0.943	MAT2B_MOUSE Methionine adenosyltransferase 2 subunit beta OS=Mus musculus OX=10090 GN=Mat2b PE=1 SV=1
2	Q9NZL9	0.0	698	334	1.000	1.000	MAT2B_HUMAN Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B PE=1 SV=1
3	A0QTF8	3.79e-23	99.8	327	0.237	0.242	RMLD_MYCS2 dTDP-4-dehydrorhamnose reductase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rmlD PE=1 SV=1
4	P26392	3.80e-19	88.2	299	0.198	0.221	RMLD_SALTY dTDP-4-dehydrorhamnose reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbD PE=1 SV=1
5	Q9L9E9	8.56e-19	87.0	288	0.266	0.309	NOVS_STRNV dTDP-4-keto-6-deoxy-D-glucose reductase OS=Streptomyces niveus OX=193462 GN=novS PE=3 SV=1
6	P37760	6.99e-18	84.7	299	0.201	0.224	RMLD_ECOLI dTDP-4-dehydrorhamnose reductase OS=Escherichia coli (strain K12) OX=83333 GN=rfbD PE=3 SV=2
7	P9WH09	5.42e-14	73.6	304	0.162	0.178	RMLD_MYCTU dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rmlD PE=1 SV=1
8	P71052	2.67e-05	48.1	598	0.141	0.079	EPSC_BACSU Probable polysaccharide biosynthesis protein EpsC OS=Bacillus subtilis (strain 168) OX=224308 GN=epsC PE=3 SV=1
9	Q566U2	6.36e-05	46.6	345	0.120	0.116	Q566U2_DANRE NAD(P) dependent steroid dehydrogenase-like OS=Danio rerio OX=7955 GN=zgc:112474 PE=1 SV=1
10	O43050	5.13e-04	43.9	340	0.132	0.129	ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase erg26, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg26 PE=3 SV=1
11	Q61694	0.002	41.6	373	0.201	0.180	3BHS5_MOUSE NADPH-dependent 3-keto-steroid reductase Hsd3b5 OS=Mus musculus OX=10090 GN=Hsd3b5 PE=1 SV=4
12	P53199	0.005	40.4	349	0.180	0.172	ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase ERG26, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG26 PE=1 SV=1
13	P26391	0.010	39.7	361	0.075	0.069	RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbB PE=1 SV=1
14	P27830	0.010	39.7	355	0.120	0.113	RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rffG PE=1 SV=3
15	Q9R1J0	0.011	39.7	362	0.102	0.094	NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus OX=10090 GN=Nsdhl PE=1 SV=1
16	Q6T1X6	0.015	39.3	309	0.105	0.113	RMD_ANETH GDP-6-deoxy-D-mannose reductase OS=Aneurinibacillus thermoaerophilus OX=143495 GN=rmd PE=1 SV=1
17	D4GP33	0.022	38.5	254	0.126	0.165	ARADH_HALVD L-arabinose 1-dehydrogenase (NAD(P)(+)) OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=xacB PE=1 SV=1
18	A0A384NPZ7	0.025	38.5	373	0.102	0.091	A0A384NPZ7_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q15738	0.025	38.5	373	0.102	0.091	NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2
20	P9WN67	0.028	38.1	314	0.135	0.143	GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=galE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01113 DapB_N	1.5e+02	13.8	Dihydrodipicolinate reductase, N-terminus
2	PF01370 Epimerase	3.3e-20	84.1	NAD dependent epimerase/dehydratase family
3	PF16363 GDP_Man_Dehyd	1.3e-05	36.5	GDP-mannose 4,6 dehydratase
4	PF07993 NAD_binding_4	0.71	20.6	Male sterility protein
5	PF02719 Polysacc_synt_2	4.7e-05	34.3	Polysaccharide biosynthesis protein
6	PF04321 RmlD_sub_bind	8.7e-84	292.5	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006477

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012240	0.999	Catalyzes the formation of S-adenosylmethionine from methionine and ATP
2	60711.ENSCSAP00000011339	0.993	Involved in the regulation of homocysteine metabolism.
3	60711.ENSCSAP00000011344	0.991	Involved in the regulation of homocysteine metabolism.
4	60711.ENSCSAP00000005947	0.990	Catalyzes the transfer of a methyl group from methyl- cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate
5	60711.ENSCSAP00000005644	0.988	Catalyzes the formation of S-adenosylmethionine from methionine and ATP
6	60711.ENSCSAP00000011624	0.938	Adenosylmethionine decarboxylase 1
7	60711.ENSCSAP00000003647	0.920	DNA (cytosine-5-)-methyltransferase 1
8	60711.ENSCSAP00000008720	0.916	DNA (cytosine-5-)-methyltransferase 3 beta
9	60711.ENSCSAP00000004839	0.913	DNA (cytosine-5-)-methyltransferase 3 alpha
10	60711.ENSCSAP00000000628	0.911	Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate
11	60711.ENSCSAP00000015627	0.905	Amine oxidase
12	60711.ENSCSAP00000010573	0.875	Kynurenine aminotransferase 1
13	60711.ENSCSAP00000003476	0.778	Terpene cyclase/mutase family member
14	60711.ENSCSAP00000012997	0.770	Farnesyl-diphosphate farnesyltransferase 1
15	60711.ENSCSAP00000008235	0.749	Ergosterol biosynthesis 28 homolog
16	60711.ENSCSAP00000008741	0.729	R3H domain containing 4
17	60711.ENSCSAP00000015296	0.729	Hydroxysteroid (17-beta) dehydrogenase 7
18	60711.ENSCSAP00000003226	0.700	GIT ArfGAP 1
19	60711.ENSCSAP00000007011	0.693	Fatty acid hydroxylase domain containing 2
20	60711.ENSCSAP00000012280	0.693	Death inducer-obliterator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.994	enzyme binding
GO:0003824	0.993	catalytic activity
GO:0030234	0.993	enzyme regulator activity
GO:0016491	0.911	oxidoreductase activity
GO:0048270	0.390	methionine adenosyltransferase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044249	0.989	cellular biosynthetic process
GO:1901576	0.964	organic substance biosynthetic process
GO:0006790	0.897	sulfur compound metabolic process
GO:0046500	0.854	S-adenosylmethionine metabolic process
GO:0044272	0.853	sulfur compound biosynthetic process
GO:0044238	0.571	primary metabolic process
GO:0065007	0.305	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.941	cytosol
GO:0032991	0.937	protein-containing complex
GO:0005739	0.908	mitochondrion
GO:0005576	0.830	extracellular region
GO:0031982	0.717	vesicle
GO:1903561	0.669	extracellular vesicle
GO:0005634	0.647	nucleus
GO:0070062	0.647	extracellular exosome
GO:0016020	0.586	membrane
GO:1902494	0.407	catalytic complex
GO:0070013	0.403	intracellular organelle lumen
GO:0031981	0.357	nuclear lumen
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.911	Oxidoreductases.

[back to server]