StarFunc result for job id Q9NZM1

User Input

>input (2061 residues)
MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLD
FSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDL
VIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLAR
RLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVVKVHVCGQTHRTRIKRGNNPF
FDELFFYNVNMTPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFVYDEPGHAVMRKWL
LLNDPEDTSSGSKGYMKVSMFVLGTGDEPPPERRDRDNDSDDVESNLLLPAGIALRWVTF
LLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIEKNANPE
WNQVVNLQIKFPSVCEKIKLTIYDWDRLTKNDVVGTTYLHLSKIAASGGEVEDFSSSGTG
AASYTVNTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVE
LATFLEKTPPDKKLEPISNDDLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIG
NYGNKFDTTCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNTL
LAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDT
QIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEIEDWLDKLMQLTEEPQNSMPDIIIWMI
RGEKRLAYARIPAHQVLYSTSGENASGKYCGKTQTIFLKYPQEKNNGPKVPVELRVNIWL
GLSAVEKKFNSFAEGTFTVFAEMYENQALMFGKWGTSGLVGRHKFSDVTGKIKLKREFFL
PPKGWEWEGEWIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDK
AASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHTHRR
RRLVRKRKKDLTQTASSTARAMEELQDQEGWEYASLIGWKFHWKQRSSDTFRRRRWRRKM
APSETHGAAAIFKLEGALGADTTEDGDEKSLEKQKHSATTVFGANTPIVSCNFDRVYIYH
LRCYVYQARNLLALDKDSFSDPYAHICFLHRSKTTEIIHSTLNPTWDQTIIFDEVEIYGE
PQTVLQNPPKVIMELFDNDQVGKDEFLGRSIFSPVVKLNSEMDITPKLLWHPVMNGDKAC
GDVLVTAELILRGKDGSNLPILPPQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNFQ
MASITSPSLVVECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDH
RQFGRKPVVGQCTIERLDRFRCDPYAGKEDIVPQLKASLLSAPPCRDIVIEMEDTKPLLA
SKLTEKEEEIVDWWSKFYASSGEHEKCGQYIQKGYSKLKIYNCELENVAEFEGLTDFSDT
FKLYRGKSDENEDPSVVGEFKGSFRIYPLPDDPSVPAPPRQFRELPDSVPQECTVRIYIV
RGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKI
SVYDYDTFTRDEKVGETIIDLENRFLSRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNV
ARFKGFPQPILSEDGSRIRYGGRDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPE
HVETRTLHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDV
ILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQL
CIVAKKEHFWSIDQTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCR
LDMIPDLKAMNPLKAKTASLFEQKSMKGWWPCYAEKDGARVMAGKVEMTLEILNEKEADE
RPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIVWRRFKWVIIGLLFLLILLLF
VAVLLYSLPNYLSMKIVKPNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7Z0E5	0.428	0.519	0.000	1647	0.191	0.239	B7Z0E5.pdb.gz	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
2	AFDB:E0CZ42	0.503	0.548	0.000	1862	0.307	0.340	E0CZ42.pdb.gz	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
3	AFDB:E7F4H1	0.786	0.773	0.000	2097	0.552	0.543	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
4	AFDB:E7FGH7	0.466	0.527	0.000	1790	0.302	0.348	E7FGH7.pdb.gz
5	AFDB:F8W4A8	0.483	0.549	0.000	1773	0.306	0.356	F8W4A8.pdb.gz	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
6	AFDB:Q17388	0.691	0.699	0.000	2034	0.235	0.238	Q17388.pdb.gz	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
7	AFDB:Q5SPC5	0.549	0.567	0.000	1992	0.327	0.338	Q5SPC5.pdb.gz	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
8	AFDB:Q9ERC5	0.494	0.507	0.000	1993	0.323	0.334	Q9ERC5.pdb.gz	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
9	AFDB:Q9ESD7	0.851	0.839	0.000	2090	0.565	0.557	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
10	AFDB:Q9ESF1	0.517	0.530	0.000	1997	0.323	0.334	Q9ESF1.pdb.gz	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
11	PDB:6kxkD	0.055	0.182	1.087E-9	553	0.020	0.074	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
12	PDB:5iz5B	0.061	0.151	1.492E-8	746	0.016	0.046	5iz5B.pdb.gz
13	PDB:5iz5A	0.061	0.146	1.388E-7	757	0.017	0.048	5iz5A.pdb.gz
14	PDB:5a52A	0.053	0.617	3.167E-7	154	0.012	0.156	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5ixcA	0.053	0.155	4.899E-7	684	0.019	0.058	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:1cjyA	0.048	0.150	1.647E-6	633	0.015	0.049	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	PDB:4rj9A	0.055	0.604	1.647E-6	161	0.015	0.193	4rj9A.pdb.gz
18	PDB:5izrC	0.048	0.144	1.647E-6	659	0.013	0.041	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:5a50A	0.055	0.598	2.099E-6	165	0.014	0.170	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:3nsjA	0.049	0.178	2.614E-5	530	0.014	0.055	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A6X1	0.0	2252	2029	0.552	0.560	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
2	E7F4H1	0.0	2284	2097	0.553	0.543	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
3	F1QIS3	0.0	2284	2088	0.552	0.545	F1QIS3_DANRE Dysferlin isoform X9 OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=3 SV=3
4	F6IA09	0.0	2256	2088	0.547	0.540	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
5	F8W4A8	0.0	671	1773	0.188	0.218	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
6	O75923	0.0	2328	2080	0.570	0.565	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
7	Q69ZN7	0.0	3886	2048	0.934	0.940	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
8	Q9ERC5	0.0	677	1993	0.191	0.197	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
9	Q9ESD7	0.0	2320	2090	0.570	0.562	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
10	Q9ESF1	0.0	669	1997	0.194	0.200	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
11	Q9NZM1	0.0	4268	2061	1.000	1.000	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
12	Q5SPC5	5.64e-138	480	1992	0.129	0.133	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
13	Q9HC10	2.97e-137	478	1997	0.130	0.134	OTOF_HUMAN Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3
14	E0CZ42	9.44e-135	469	1862	0.129	0.143	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
15	Q17388	1.45e-110	395	2034	0.185	0.187	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
16	B2D6N9	4.96e-106	380	1907	0.180	0.195	B2D6N9_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=3 SV=1
17	B7Z0E7	6.68e-101	359	1351	0.136	0.208	B7Z0E7_DROME Misfire, isoform D OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
18	B7Z0E6	2.58e-100	358	1439	0.136	0.195	B7Z0E6_DROME Misfire, isoform I OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
19	B7Z0E5	5.80e-100	360	1647	0.136	0.171	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
20	B7Z0E8	1.11e-96	329	648	0.100	0.319	B7Z0E8_DROME Misfire, isoform J OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	4e-95	324.3	C2 domain
2	PF08165 FerA	1.8e-20	83.9	FerA (NUC095) domain
3	PF08150 FerB	7.9e-29	111.4	FerB (NUC096) domain
4	PF08151 FerI	5.3e-17	72.9	FerI (NUC094) domain
5	PF16165 Ferlin_C	6.9e-26	102.5	Ferlin C-terminus
6	PF00792 PI3K_C2	1.1e+02	14.2	Phosphoinositide 3-kinase C2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373905	0.973	Dynamin-2
2	9606.ENSP00000263923	0.944	Vascular endothelial growth factor receptor 2
3	9606.ENSP00000263277	0.915	EH domain-containing protein 2
4	9606.ENSP00000478570	0.914	Vascular endothelial growth factor A
5	9606.ENSP00000327116	0.909	EH domain-containing protein 3
6	9606.ENSP00000264033	0.900	E3 ubiquitin-protein ligase CBL
7	9606.ENSP00000367263	0.826	Neuroblast differentiation-associated protein AHNAK
8	9606.ENSP00000365261	0.697	Leukocyte-specific transcript 1 protein
9	9606.ENSP00000415556	0.685	DDB1- and CUL4-associated factor 11
10	9606.ENSP00000346103	0.681	Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
11	9606.ENSP00000298832	0.678	Tubulin polyglutamylase TTLL5
12	9606.ENSP00000462729	0.678	OTU domain-containing protein 7B
13	9606.ENSP00000380349	0.676	Calpain-3
14	9606.ENSP00000298248	0.674	Lambda-crystallin homolog
15	9606.ENSP00000387365	0.672	Periodic tryptophan protein 1 homolog
16	9606.ENSP00000479598	0.671	RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
17	9606.ENSP00000369461	0.670	Enoyl-CoA delta isomerase 2, mitochondrial
18	9606.ENSP00000286371	0.668	Sodium/potassium-transporting ATPase subunit beta-3
19	9606.ENSP00000363869	0.667	V-set and immunoglobulin domain-containing protein 4
20	9606.ENSP00000480828	0.664	Squalene synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	1.000	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050896	0.946	response to stimulus
GO:0050789	0.816	regulation of biological process
GO:0032501	0.811	multicellular organismal process
GO:0006950	0.754	response to stress
GO:0032502	0.746	developmental process
GO:0016043	0.726	cellular component organization
GO:0050794	0.686	regulation of cellular process
GO:0048856	0.620	anatomical structure development
GO:0071704	0.511	organic substance metabolic process
GO:0061024	0.462	membrane organization
GO:0010256	0.460	endomembrane system organization
GO:0003008	0.435	system process
GO:0003012	0.434	muscle system process
GO:0044238	0.391	primary metabolic process
GO:0042060	0.388	wound healing
GO:0044237	0.385	cellular metabolic process
GO:0007009	0.352	plasma membrane organization
GO:0061061	0.331	muscle structure development
GO:0048519	0.310	negative regulation of biological process
GO:0030154	0.310	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.945	membrane-bounded organelle
GO:0012505	0.905	endomembrane system
GO:0043231	0.887	intracellular membrane-bounded organelle
GO:0005737	0.874	cytoplasm
GO:0031982	0.829	vesicle
GO:0005576	0.491	extracellular region
GO:0005634	0.488	nucleus
GO:0031410	0.415	cytoplasmic vesicle
GO:1903561	0.406	extracellular vesicle
GO:0070062	0.311	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]