StarFunc result for job id Q9NZM3

User Input

>input (1697 residues)
MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPI
PYSSSTLPHGSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAV
PQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGDGQLKAE
EFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEEPQKKLP
VTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEE
IVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQL
QQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLD
ALEKETASKLSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRETYNTQQLA
LEQLYKIKRDKLKEIERKRLELMQKKKLEDEAARKAKQGKENLWKENLRKEEEEKQKRLQ
EEKTQEKIQEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEARNHDEMSFNS
GDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSA
TSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVEN
LKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVK
REEPEALYAAVNKKPTSAAYSVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTG
SIGDRSGIFPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLI
LILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAA
NNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQTL
DTMQPIERKRQGYIHELIQTEERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKEL
IMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTD
EDTDFKEFLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKL
ALERAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGK
LYKTKSNKELHGFLFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLV
KLPTDPSSDEPVFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQA
RSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNC
QFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTG
EVWVRFDLQLFEQKTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15811	0.414	0.408	0.000	1721	0.605	0.596	Q15811.pdb.gz	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
2	AFDB:Q9NZM3	1.000	1.000	0.000	1697	1.000	1.000	Q9NZM3.pdb.gz	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
3	AFDB:Q9Z0R6	0.431	0.440	0.000	1659	0.907	0.928	Q9Z0R6.pdb.gz	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
4	AFDB:Q8INU2	0.081	0.120	1.429E-61	1014	0.232	0.388	Q8INU2.pdb.gz	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
5	AFDB:M9ND00	0.094	0.126	2.586E-61	1190	0.226	0.323	M9ND00.pdb.gz	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
6	AFDB:Q9U2T9	0.107	0.146	1.057E-56	1085	0.192	0.300	Q9U2T9.pdb.gz	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
7	PDB:4mt6A	0.155	0.515	9.072E-21	389	0.050	0.219	4mt6A.pdb.gz
8	AFDB:Q9VVC6	0.186	0.157	3.278E-19	2029	0.101	0.084	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
9	AFDB:Q8MMD3	0.062	0.093	1.824E-16	1106	0.117	0.179	Q8MMD3.pdb.gz	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
10	PDB:7rx9A	0.104	0.396	6.383E-16	432	0.049	0.194	7rx9A.pdb.gz
11	AFDB:Q60902	0.071	0.126	1.027E-15	907	0.116	0.217	Q60902.pdb.gz	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
12	AFDB:Q498M5	0.045	0.089	7.096E-12	735	0.055	0.128	Q498M5.pdb.gz	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
13	PDB:4rj9A	0.071	0.664	7.877E-10	161	0.019	0.205	4rj9A.pdb.gz
14	PDB:4gouA	0.109	0.324	1.573E-9	507	0.031	0.103	4gouA.pdb.gz
15	PDB:5a50A	0.070	0.631	3.140E-9	165	0.022	0.224	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5a52A	0.068	0.697	4.437E-9	154	0.019	0.208	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5iz5B	0.069	0.153	3.710E-8	746	0.018	0.040	5iz5B.pdb.gz
18	PDB:5izrC	0.066	0.165	4.302E-8	659	0.018	0.046	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:5ixcA	0.068	0.163	4.749E-8	684	0.018	0.044	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
20	PDB:5iz5A	0.066	0.145	4.749E-8	757	0.018	0.040	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W7U0	0.0	836	1149	0.332	0.491	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
2	Q15811	0.0	1929	1721	0.617	0.608	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
3	Q6GMY7	0.0	588	648	0.224	0.586	Q6GMY7_HUMAN ITSN1 protein (Fragment) OS=Homo sapiens OX=9606 GN=ITSN1 PE=2 SV=1
4	Q9NZM3	0.0	3506	1697	1.000	1.000	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
5	Q9WVE9	0.0	1899	1713	0.606	0.600	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
6	Q9Z0R4	0.0	1929	1714	0.610	0.604	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
7	Q9Z0R6	0.0	3044	1659	0.907	0.928	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
8	Q1WWC9	4.90e-162	525	1096	0.235	0.364	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
9	M9PBF6	5.90e-162	524	1088	0.235	0.367	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
10	Q9VIF7	7.49e-162	524	1097	0.235	0.364	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
11	O61618	2.14e-161	523	1094	0.236	0.366	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
12	M9ND00	5.62e-158	516	1190	0.235	0.335	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	Q8INU2	3.49e-125	421	1014	0.203	0.339	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	M9PDC7	4.71e-125	420	1005	0.202	0.340	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	O61639	5.50e-125	420	1011	0.200	0.335	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
16	Q8T068	1.31e-70	253	662	0.126	0.323	Q8T068_DROME LD23686p OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
17	E6N0W0	2.87e-54	207	825	0.087	0.179	E6N0W0_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=1
18	E6N0W1	6.39e-54	203	632	0.087	0.234	E6N0W1_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=1
19	Q9U2T9	6.34e-53	206	1085	0.087	0.136	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
20	Q9BIF4	9.11e-34	143	796	0.086	0.183	Q9BIF4_CAEEL EHS-1 OS=Caenorhabditis elegans OX=6239 GN=ehs-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	5.2e-20	83.0	C2 domain
2	PF00036 EF-hand_1	2.6e-06	37.6	EF hand
3	PF12763 EF-hand_4	7.1e-25	98.3	Cytoskeletal-regulatory complex EF hand
4	PF13202 EF-hand_5	3.6	18.4	EF hand
5	PF13405 EF-hand_6	0.00042	30.9	EF-hand domain
6	PF13499 EF-hand_7	0.0028	29.4	EF-hand domain pair
7	PF00169 PH	11	18.0	PH domain
8	PF16652 PH_13	8.6e-72	251.6	Pleckstrin homology domain
9	PF00621 RhoGEF	1.4e-39	147.7	RhoGEF domain
10	PF00018 SH3_1	1.1e-58	205.9	SH3 domain
11	PF07653 SH3_2	1e-53	190.2	Variant SH3 domain
12	PF14604 SH3_9	8.1e-57	200.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.976	Cell division control protein 42 homolog
2	9606.ENSP00000360798	0.963	Epidermal growth factor receptor substrate 15
3	9606.ENSP00000393313	0.940	Epidermal growth factor receptor substrate 15-like 1
4	9606.ENSP00000298316	0.931	ADP-ribosylation factor 6
5	9606.ENSP00000345195	0.922	Ubiquilin-2
6	9606.ENSP00000370719	0.920	Intersectin-1
7	9606.ENSP00000314615	0.913	ADP-ribosylation factor GTPase-activating protein 1
8	9606.ENSP00000362014	0.902	Dynamin-1
9	9606.ENSP00000441158	0.901	Clathrin heavy chain 2
10	9606.ENSP00000327694	0.900	AP-2 complex subunit alpha-2
11	9606.ENSP00000351926	0.892	AP-2 complex subunit alpha-1
12	9606.ENSP00000242285	0.881	Clathrin light chain A
13	9606.ENSP00000373905	0.880	Dynamin-2
14	9606.ENSP00000479606	0.874	Clathrin heavy chain 1
15	9606.ENSP00000409667	0.872	Synaptojanin-1
16	9606.ENSP00000473001	0.861	F-BAR domain only protein 1
17	9606.ENSP00000406209	0.854	Epsin-1
18	9606.ENSP00000320543	0.846	Epsin-2
19	9606.ENSP00000393776	0.843	F-BAR domain only protein 2
20	9606.ENSP00000483453	0.837	Synergin gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.313	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.913	positive regulation of biological process
GO:0048522	0.904	positive regulation of cellular process
GO:0009987	0.901	cellular process
GO:0051128	0.863	regulation of cellular component organization
GO:0051094	0.704	positive regulation of developmental process
GO:0040008	0.642	regulation of growth
GO:0022604	0.623	regulation of cell morphogenesis
GO:1903859	0.567	regulation of dendrite extension
GO:0030307	0.516	positive regulation of cell growth
GO:0048583	0.431	regulation of response to stimulus
GO:0051179	0.424	localization
GO:0050896	0.393	response to stimulus
GO:0048519	0.374	negative regulation of biological process
GO:0006810	0.373	transport
GO:0048523	0.363	negative regulation of cellular process
GO:0023051	0.324	regulation of signaling
GO:0010646	0.324	regulation of cell communication
GO:0009966	0.312	regulation of signal transduction
GO:0007154	0.307	cell communication
GO:0023052	0.305	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	1.000	cytosol
GO:0031982	0.998	vesicle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005576	0.992	extracellular region
GO:0016020	0.988	membrane
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005886	0.983	plasma membrane
GO:0012505	0.967	endomembrane system
GO:0005615	0.948	extracellular space
GO:0065010	0.945	extracellular membrane-bounded organelle
GO:1903561	0.941	extracellular vesicle
GO:0070062	0.933	extracellular exosome
GO:0005856	0.924	cytoskeleton
GO:0005634	0.806	nucleus
GO:0097708	0.756	intracellular vesicle
GO:0098590	0.573	plasma membrane region
GO:0030054	0.561	cell junction
GO:0031410	0.557	cytoplasmic vesicle
GO:0015630	0.534	microtubule cytoskeleton
GO:0043233	0.479	organelle lumen
GO:0070013	0.474	intracellular organelle lumen
GO:0045202	0.381	synapse
GO:0031981	0.372	nuclear lumen
GO:0005815	0.367	microtubule organizing center
GO:0005813	0.354	centrosome
GO:0005654	0.352	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]