StarFunc result for job id Q9NZM5

User Input

>input (478 residues)
MAAGGSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRRLAQEPLGLEV
DQFLEDVRLQERTSGGLLSEAPNEKLFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDL
ILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLAKQGELPREVRRAQARLLNPSATRA
KPGPQDTVERPFYDLWASDNPLDRPLVGQDEFFLEQTKKKGVKRPARLHTKPSQAPAVEV
APAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLALPATEQAATQESTFQELCEG
LLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKTEQQRRREKAVHRLRVQQAALRA
ARLRHQELFRLRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL
SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZM5	1.000	1.000	1.921E-73	478	1.000	1.000	Q9NZM5.pdb.gz	NOP53_HUMAN Ribosome biogenesis protein NOP53 OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=2
2	AFDB:Q8BK35	0.383	0.379	1.403E-59	484	0.824	0.814	Q8BK35.pdb.gz	NOP53_MOUSE Ribosome biogenesis protein NOP53 OS=Mus musculus OX=10090 GN=Nop53 PE=1 SV=1
3	AFDB:M0QZ34	0.163	0.325	2.608E-21	200	0.418	1.000	M0QZ34.pdb.gz	M0QZ34_HUMAN Ribosome biogenesis protein NOP53 (Fragment) OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=1
4	AFDB:Q9NEU5	0.311	0.336	8.379E-17	438	0.249	0.272	Q9NEU5.pdb.gz	NOP53_CAEEL Ribosome biogenesis protein NOP53 OS=Caenorhabditis elegans OX=6239 GN=Y39B6A.33 PE=3 SV=1
5	AFDB:F4IH36	0.312	0.330	4.117E-12	449	0.220	0.234	F4IH36.pdb.gz	F4IH36_ARATH Ribosome biogenesis protein NOP53 OS=Arabidopsis thaliana OX=3702 GN=SMO4 PE=1 SV=1
6	AFDB:Q12080	0.237	0.247	7.135E-11	455	0.234	0.246	Q12080.pdb.gz	NOP53_YEAST Ribosome biogenesis protein NOP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP53 PE=1 SV=1
7	AFDB:Q38D90	0.332	0.483	1.884E-10	311	0.161	0.248	Q38D90.pdb.gz	Q38D90_TRYB2 Ribosome biogenesis protein NOP53 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4190 PE=3 SV=1
8	AFDB:M0QZU5	0.141	0.622	3.481E-8	99	0.169	0.818	M0QZU5.pdb.gz	M0QZU5_HUMAN Ribosome biogenesis protein NOP53 (Fragment) OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=1
9	PDB:3jctq	0.202	0.498	6.512E-4	183	0.105	0.273	3jctq.pdb.gz	Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
10	AFDB:Q57ZR8	0.075	0.103	3.792E-1	334	0.111	0.159	Q57ZR8.pdb.gz	Q57ZR8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.340 PE=4 SV=1
11	AFDB:B3DJE0	0.086	0.060	4.833E-1	759	0.186	0.117	B3DJE0.pdb.gz
12	PDB:7nacm	0.070	0.057	4.319	666	0.046	0.033	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:6ylxq	0.061	0.318	4.589	87	0.050	0.276	6ylxq.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
14	PDB:7rroP	0.081	0.099	4.876	373	0.115	0.147	7rroP.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:5c0xK	0.044	0.057	7.018	350	0.019	0.026	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
16	PDB:7nvrn	0.061	0.147	8.946	132	0.044	0.159	7nvrn.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BK35	0.0	707	484	0.824	0.814	NOP53_MOUSE Ribosome biogenesis protein NOP53 OS=Mus musculus OX=10090 GN=Nop53 PE=1 SV=1
2	Q9NZM5	0.0	946	478	1.000	1.000	NOP53_HUMAN Ribosome biogenesis protein NOP53 OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=2
3	M0QX73	7.68e-138	399	265	0.439	0.792	M0QX73_HUMAN Ribosome biogenesis protein NOP53 (Fragment) OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=1
4	M0QZ34	2.83e-76	239	200	0.243	0.580	M0QZ34_HUMAN Ribosome biogenesis protein NOP53 (Fragment) OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=1
5	M0QYZ9	9.61e-50	169	149	0.178	0.570	M0QYZ9_HUMAN Ribosome biogenesis protein NOP53 (Fragment) OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=1
6	M0QZU5	2.08e-49	166	99	0.174	0.838	M0QZU5_HUMAN Ribosome biogenesis protein NOP53 (Fragment) OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=1
7	Q9NEU5	1.59e-18	90.1	438	0.255	0.279	NOP53_CAEEL Ribosome biogenesis protein NOP53 OS=Caenorhabditis elegans OX=6239 GN=Y39B6A.33 PE=3 SV=1
8	F4IH36	3.21e-07	55.1	449	0.059	0.062	F4IH36_ARATH Ribosome biogenesis protein NOP53 OS=Arabidopsis thaliana OX=3702 GN=SMO4 PE=1 SV=1
9	Q12080	1.60e-06	52.8	455	0.059	0.062	NOP53_YEAST Ribosome biogenesis protein NOP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP53 PE=1 SV=1
10	Q38D90	0.002	42.7	311	0.146	0.225	Q38D90_TRYB2 Ribosome biogenesis protein NOP53 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4190 PE=3 SV=1
11	Q9L7Q2	1.3	34.3	1906	0.121	0.030	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
12	B0R0I6	5.3	32.3	2511	0.096	0.018	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
13	P54697	6.8	32.0	2245	0.077	0.016	MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoJ PE=3 SV=2
14	P34345	9.7	30.8	250	0.067	0.128	GSTO1_CAEEL Glutathione transferase omega-1 OS=Caenorhabditis elegans OX=6239 GN=gsto-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07767 Nop53	1.1e-91	319.8	Nop53 (60S ribosomal biogenesis)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354040	0.996	Nucleolar GTP-binding protein 1
2	9606.ENSP00000230640	0.991	Superkiller viralicidic activity 2-like 2
3	9606.ENSP00000362153	0.990	Nucleolar GTP-binding protein 2
4	9606.ENSP00000483484	0.989	Ribosome biogenesis protein NSA2 homolog
5	9606.ENSP00000396673	0.987	pre-rRNA processing protein FTSJ3
6	9606.ENSP00000402338	0.987	Ribosome production factor 2 homolog
7	9606.ENSP00000285814	0.983	Nucleolar protein interacting with the FHA domain of MKI67
8	9606.ENSP00000294724	0.981	Glycogen debranching enzyme
9	9606.ENSP00000264279	0.976	Nucleolar protein 58
10	9606.ENSP00000346725	0.976	Pescadillo homolog
11	9606.ENSP00000260443	0.970	Probable ribosome biogenesis protein RLP24
12	9606.ENSP00000407323	0.967	Probable rRNA-processing protein EBP2
13	9606.ENSP00000460871	0.967	Ribosomal L1 domain-containing protein 1
14	9606.ENSP00000353246	0.963	Protein MAK16 homolog
15	9606.ENSP00000322396	0.961	Ribosome biogenesis regulatory protein homolog
16	9606.ENSP00000361021	0.961	Phosphatase and tensin homolog
17	9606.ENSP00000254940	0.958	60S ribosome subunit biogenesis protein NIP7 homolog
18	9606.ENSP00000254803	0.954	Something about silencing protein 10
19	9606.ENSP00000363676	0.953	60S ribosomal protein L11
20	9606.ENSP00000371858	0.947	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding
GO:0008097	1.000	5S rRNA binding
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.989	biological regulation
GO:0050794	0.981	regulation of cellular process
GO:0044238	0.977	primary metabolic process
GO:0071704	0.965	organic substance metabolic process
GO:0051246	0.958	regulation of protein metabolic process
GO:0044237	0.954	cellular metabolic process
GO:0048523	0.950	negative regulation of cellular process
GO:0006807	0.946	nitrogen compound metabolic process
GO:0043170	0.944	macromolecule metabolic process
GO:0010604	0.926	positive regulation of macromolecule metabolic process
GO:0031323	0.924	regulation of cellular metabolic process
GO:0051179	0.920	localization
GO:1901796	0.917	regulation of signal transduction by p53 class mediator
GO:0031331	0.911	positive regulation of cellular catabolic process
GO:0051173	0.910	positive regulation of nitrogen compound metabolic process
GO:1903052	0.900	positive regulation of proteolysis involved in protein catabolic process
GO:1902532	0.898	negative regulation of intracellular signal transduction
GO:0045732	0.898	positive regulation of protein catabolic process
GO:0033365	0.883	protein localization to organelle
GO:0034641	0.868	cellular nitrogen compound metabolic process
GO:0032434	0.865	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034504	0.835	protein localization to nucleus
GO:0044085	0.833	cellular component biogenesis
GO:2000060	0.798	positive regulation of ubiquitin-dependent protein catabolic process
GO:0044260	0.797	cellular macromolecule metabolic process
GO:0046483	0.796	heterocycle metabolic process
GO:0090304	0.787	nucleic acid metabolic process
GO:0022613	0.782	ribonucleoprotein complex biogenesis
GO:0050896	0.768	response to stimulus
GO:0010468	0.761	regulation of gene expression
GO:0032436	0.753	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0042254	0.741	ribosome biogenesis
GO:0010556	0.677	regulation of macromolecule biosynthetic process
GO:0031326	0.677	regulation of cellular biosynthetic process
GO:0019219	0.575	regulation of nucleobase-containing compound metabolic process
GO:0051726	0.564	regulation of cell cycle
GO:0051252	0.560	regulation of RNA metabolic process
GO:1901987	0.481	regulation of cell cycle phase transition
GO:0051716	0.313	cellular response to stimulus
GO:0016043	0.307	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.995	nucleoplasm
GO:0005829	0.973	cytosol
GO:0005694	0.699	chromosome
GO:0001650	0.529	fibrillar center
GO:0000785	0.446	chromatin
GO:0032991	0.311	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]