StarFunc result for job id Q9NZN1

User Input

>input (696 residues)
MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYI
RTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI
RNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEIL
WYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDK
PPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWE
SDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVEL
AGGLGAILLLLVCLVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN
QETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPN
YVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWH
GPKCNKLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTAL
ATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQ
RPQTKSSREQNPDEAHTNSAILPLLPRETSISSVIW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B6ZK77	0.685	0.681	0.000	700	0.756	0.751	B6ZK77.pdb.gz	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
2	AFDB:P59824	0.829	0.829	0.000	696	0.989	0.989	P59824.pdb.gz	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
3	AFDB:Q9NP60	0.518	0.525	5.778E-101	686	0.611	0.620	Q9NP60.pdb.gz	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
4	AFDB:B6ZK78	0.599	0.611	7.386E-97	681	0.568	0.580	B6ZK78.pdb.gz	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
5	AFDB:P13504	0.336	0.390	2.984E-46	576	0.233	0.281	P13504.pdb.gz	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
6	AFDB:Q02955	0.337	0.390	1.296E-45	576	0.224	0.271	Q02955.pdb.gz	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
7	AFDB:P14778	0.307	0.365	4.194E-45	569	0.220	0.269	P14778.pdb.gz	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
8	AFDB:P14719	0.390	0.463	3.123E-40	567	0.213	0.261	P14719.pdb.gz	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
9	AFDB:Q62611	0.346	0.410	7.802E-38	566	0.201	0.247	Q62611.pdb.gz	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1
10	AFDB:A0A060WMR1	0.275	0.475	2.426E-19	370	0.126	0.238	A0A060WMR1.pdb.gz	A0A060WMR1_ONCMY TIR domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00035357001 PE=4 SV=1
11	PDB:6dldD	0.150	0.300	2.804E-13	269	0.082	0.212	6dldD.pdb.gz
12	PDB:1e07A	0.128	0.137	2.295E-11	642	0.070	0.076	1e07A.pdb.gz
13	PDB:6dlfA	0.119	0.272	2.581E-11	236	0.076	0.225	6dlfA.pdb.gz
14	PDB:5oj2B	0.117	0.118	3.894E-11	692	0.088	0.088	5oj2B.pdb.gz
15	PDB:3o3uN	0.201	0.234	9.966E-11	580	0.049	0.059	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
16	PDB:2rcjC	0.159	0.201	1.575E-9	523	0.078	0.103	2rcjC.pdb.gz
17	PDB:7sqcO0	0.106	0.069	6.082E-9	1140	0.062	0.038	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6feyB	0.120	0.366	3.542E-8	207	0.056	0.188	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
19	PDB:1q0xL	0.168	0.402	7.600E-8	212	0.046	0.151	1q0xL.pdb.gz
20	PDB:6enyC	0.173	0.276	8.548E-8	364	0.057	0.110	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6ZK77	0.0	1122	700	0.756	0.751	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
2	B6ZK78	0.0	823	681	0.573	0.586	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
3	P59823	0.0	1423	695	0.983	0.984	IRPL1_MOUSE Interleukin-1 receptor accessory protein-like 1 OS=Mus musculus OX=10090 GN=Il1rapl1 PE=1 SV=1
4	P59824	0.0	1434	696	0.989	0.989	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
5	Q9NP60	0.0	870	686	0.612	0.621	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
6	Q9NZN1	0.0	1448	696	1.000	1.000	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
7	Q63621	1.91e-89	292	570	0.276	0.337	IL1AP_RAT Interleukin-1 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il1rap PE=2 SV=1
8	Q9NPH3	2.02e-89	292	570	0.279	0.340	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
9	Q61730	2.89e-89	291	570	0.269	0.328	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
10	Q70YG5	1.14e-76	258	568	0.247	0.303	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
11	Q13478	1.20e-54	198	541	0.249	0.320	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
12	P13504	5.82e-53	194	576	0.220	0.266	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
13	P14778	1.61e-51	190	569	0.221	0.271	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
14	O95256	3.61e-51	189	599	0.216	0.250	I18RA_HUMAN Interleukin-18 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL18RAP PE=1 SV=1
15	Q02955	7.60e-50	185	576	0.214	0.259	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
16	Q90874	2.65e-48	181	555	0.233	0.292	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
17	Q61098	7.93e-45	170	537	0.228	0.296	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
18	P14719	1.08e-42	165	567	0.195	0.240	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
19	Q01638	1.71e-42	164	556	0.190	0.237	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
20	Q62611	1.66e-41	161	566	0.195	0.240	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	4.5e-13	60.4	Immunoglobulin I-set domain
2	PF00047 ig	3.3e-12	57.7	Immunoglobulin domain
3	PF13895 Ig_2	1.2e-15	68.9	Immunoglobulin domain
4	PF13927 Ig_3	3.8e-13	61.1	Immunoglobulin domain
5	PF18452 Ig_6	2.3e-05	35.7	Immunoglobulin domain
6	PF16706 Izumo-Ig	1.8e+02	13.5	Izumo-like Immunoglobulin domain
7	PF01582 TIR	2.8e-24	97.4	TIR domain
8	PF13676 TIR_2	0.0049	28.9	TIR domain
9	PF07686 V-set	5.3e-05	34.7	Immunoglobulin V-set domain
10	PF08204 V-set_CD47	34	15.8	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368278

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370593	0.989	Receptor-type tyrosine-protein phosphatase delta
2	9606.ENSP00000361475	0.982	Neuronal calcium sensor 1
3	9606.ENSP00000376893	0.925	Interleukin-1 family member 10
4	9606.ENSP00000378974	0.905	Mitogen-activated protein kinase 8
5	9606.ENSP00000349932	0.883	Receptor-type tyrosine-protein phosphatase S
6	9606.ENSP00000347710	0.841	Oligophrenin-1
7	9606.ENSP00000412461	0.806	Rho GTPase-activating protein 22
8	9606.ENSP00000424544	0.800	Tumor suppressor candidate 3
9	9606.ENSP00000370420	0.721	Variable charge X-linked protein 3B
10	9606.ENSP00000321309	0.720	Variable charge X-linked protein 2
11	9606.ENSP00000370447	0.720	Variable charge X-linked protein 1
12	9606.ENSP00000370213	0.700	H(+)/Cl(-) exchange transporter 4
13	9606.ENSP00000471502	0.684	Leucine-rich repeat-containing protein 4B
14	9606.ENSP00000368332	0.671	Homeobox protein ARX
15	9606.ENSP00000312535	0.654	Leucine-rich repeat and fibronectin type-III domain-containing protein 4
16	9606.ENSP00000326948	0.641	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
17	9606.ENSP00000368304	0.639	Melanoma-associated antigen B10
18	9606.ENSP00000396103	0.630	Myelin transcription factor 1-like protein
19	9606.ENSP00000339730	0.628	Thrombospondin-4
20	9606.ENSP00000357869	0.623	Phosphatidylinositol 4-kinase beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.824	transmembrane signaling receptor activity
GO:0005102	0.711	signaling receptor binding
GO:0004896	0.681	cytokine receptor activity
GO:0004908	0.592	interleukin-1 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0050803	0.985	regulation of synapse structure or activity
GO:1901888	0.980	regulation of cell junction assembly
GO:0050807	0.979	regulation of synapse organization
GO:0051963	0.964	regulation of synapse assembly
GO:0032501	0.954	multicellular organismal process
GO:0048856	0.926	anatomical structure development
GO:0007275	0.904	multicellular organism development
GO:0048731	0.855	system development
GO:0099174	0.839	regulation of presynapse organization
GO:0050808	0.817	synapse organization
GO:1905606	0.816	regulation of presynapse assembly
GO:0048519	0.806	negative regulation of biological process
GO:0048523	0.796	negative regulation of cellular process
GO:0007399	0.737	nervous system development
GO:0023052	0.673	signaling
GO:0031344	0.655	regulation of cell projection organization
GO:0048518	0.633	positive regulation of biological process
GO:0060627	0.561	regulation of vesicle-mediated transport
GO:0051046	0.559	regulation of secretion
GO:0050896	0.551	response to stimulus
GO:0007154	0.514	cell communication
GO:1903531	0.495	negative regulation of secretion by cell
GO:0045920	0.478	negative regulation of exocytosis
GO:0048522	0.476	positive regulation of cellular process
GO:0120035	0.410	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.373	regulation of neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0030054	0.990	cell junction
GO:0071944	0.986	cell periphery
GO:0005886	0.974	plasma membrane
GO:0045202	0.961	synapse
GO:0098978	0.788	glutamatergic synapse
GO:0043226	0.776	organelle
GO:0005622	0.696	intracellular anatomical structure
GO:0043229	0.620	intracellular organelle
GO:0043227	0.611	membrane-bounded organelle
GO:0005737	0.566	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]