StarFunc result for job id Q9NZN5

User Input

>input (1544 residues)
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDAS
RPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGY
LPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTG
DIATCYSPRTSTESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R4H2	0.605	0.606	0.000	1543	0.893	0.894	Q8R4H2.pdb.gz	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
2	AFDB:Q9NZN5	1.000	1.000	0.000	1544	1.000	1.000	Q9NZN5.pdb.gz	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
3	AFDB:Q68FM7	0.357	0.355	1.443E-76	1552	0.321	0.319	Q68FM7.pdb.gz	Q68FM7_MOUSE Rho guanine nucleotide exchange factor (GEF) 11 OS=Mus musculus OX=10090 GN=Arhgef11 PE=1 SV=1
4	AFDB:A1ZAN6	0.269	0.172	7.726E-45	2559	0.271	0.163	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
5	AFDB:B0S635	0.149	0.337	4.172E-26	555	0.124	0.346	B0S635.pdb.gz
6	AFDB:A0A286YAR8	0.229	0.334	4.189E-22	1038	0.110	0.164	A0A286YAR8.pdb.gz
7	AFDB:O94827	0.199	0.287	1.203E-19	1006	0.109	0.167	O94827.pdb.gz	PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5 PE=1 SV=4
8	AFDB:Q22354	0.193	0.322	3.378E-18	862	0.099	0.177	Q22354.pdb.gz	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
9	PDB:4mt6A	0.173	0.561	1.962E-14	389	0.048	0.190	4mt6A.pdb.gz
10	PDB:7rx9A	0.118	0.403	3.323E-14	432	0.045	0.162	7rx9A.pdb.gz
11	AFDB:E9Q7D5	0.196	0.192	1.414E-12	1581	0.109	0.107	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
12	AFDB:Q5JU85	0.088	0.090	5.272E-12	1488	0.120	0.124	Q5JU85.pdb.gz	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
13	PDB:4gouA	0.119	0.321	8.598E-7	507	0.027	0.081	4gouA.pdb.gz
14	PDB:5yqrA	0.062	0.290	3.214E-4	268	0.024	0.138	5yqrA.pdb.gz
15	PDB:6bbpA	0.059	0.153	1.252E-3	520	0.029	0.087	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:7pe9I	0.051	0.242	1.942E-3	317	0.015	0.073	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
17	PDB:7p73A	0.051	0.180	2.120E-3	420	0.017	0.064	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7pcbA	0.051	0.187	2.883E-3	415	0.023	0.084	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:5n7dA	0.052	0.181	3.751E-3	423	0.022	0.080	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:7pc3A	0.051	0.187	4.279E-3	405	0.016	0.062	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R4H2	0.0	2696	1543	0.893	0.894	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
2	Q9NZN5	0.0	3192	1544	1.000	1.000	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
3	Q61210	6.94e-166	526	920	0.218	0.366	ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus OX=10090 GN=Arhgef1 PE=1 SV=2
4	Q9Z1I6	9.43e-163	518	919	0.209	0.351	ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Arhgef1 PE=2 SV=1
5	Q92888	2.68e-157	503	912	0.210	0.355	ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=2
6	Q9ES67	6.72e-111	388	1527	0.133	0.134	ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus OX=10116 GN=Arhgef11 PE=1 SV=1
7	O15085	9.24e-111	388	1522	0.131	0.133	ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1
8	Q68FM7	1.54e-107	379	1552	0.127	0.126	Q68FM7_MOUSE Rho guanine nucleotide exchange factor (GEF) 11 OS=Mus musculus OX=10090 GN=Arhgef11 PE=1 SV=1
9	M0QZR4	8.90e-107	366	968	0.123	0.196	M0QZR4_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=1
10	G5EFE1	1.73e-77	285	1340	0.108	0.124	G5EFE1_CAEEL Guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=rhgf-1 PE=1 SV=1
11	Q49U75	4.70e-68	256	1417	0.124	0.135	Q49U75_DANRE PDZ-RhoGEF OS=Danio rerio OX=7955 GN=arhgef11 PE=1 SV=1
12	Q8T9E3	6.39e-60	231	2555	0.098	0.059	Q8T9E3_DROME SD04476p OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
13	A0A0B4K7T7	6.50e-60	231	2557	0.098	0.059	A0A0B4K7T7_DROME Rho guanine nucleotide exchange factor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
14	O44381	6.56e-60	231	2559	0.098	0.059	O44381_DROME Shar pei/DRhoGEF2 OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
15	A1ZAN6	6.62e-60	230	2559	0.098	0.059	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
16	A0A0B4LFF8	7.43e-60	230	2456	0.098	0.061	A0A0B4LFF8_DROME Rho guanine nucleotide exchange factor 2, isoform H OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
17	A1ZAN7	1.05e-59	229	2205	0.098	0.068	A1ZAN7_DROME Rho guanine nucleotide exchange factor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
18	O44113	1.05e-58	226	2559	0.097	0.058	O44113_DROME Putative guanine nucleotide exchange factor RhoGEF2 OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=2 SV=1
19	F6P6M2	2.18e-47	189	1753	0.077	0.068	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
20	B2DCZ9	1.43e-41	169	961	0.092	0.148	ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	9.9e-09	46.8	PDZ domain
2	PF13180 PDZ_2	0.0049	28.5	PDZ domain
3	PF17820 PDZ_6	2.2e-07	42.0	PDZ domain
4	PF02163 Peptidase_M50	0.12	23.2	Peptidase family M50
5	PF17838 PH_16	2e-39	145.8	PH domain
6	PF09128 RGS-like	4.7e-88	305.5	Regulator of G protein signalling-like domain
7	PF00621 RhoGEF	9.6e-33	125.4	RhoGEF domain
8	PF06479 Ribonuc_2-5A	1.4e+02	14.0	Ribonuclease 2-5A
9	PF14685 Tricorn_PDZ	5.9e+02	11.9	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000351338	0.995	Plexin-B1
3	9606.ENSP00000400717	0.991	Guanine nucleotide-binding protein subunit alpha-13
4	9606.ENSP00000398632	0.990	CD44 antigen
5	9606.ENSP00000286548	0.987	Guanine nucleotide-binding protein G(q) subunit alpha
6	9606.ENSP00000275364	0.985	Guanine nucleotide-binding protein subunit alpha-12
7	9606.ENSP00000285735	0.985	Rho-related GTP-binding protein RhoC
8	9606.ENSP00000272233	0.967	Rho-related GTP-binding protein RhoB
9	9606.ENSP00000409171	0.956	Plexin-B2
10	9606.ENSP00000441913	0.921	Rho guanine nucleotide exchange factor 28
11	9606.ENSP00000364893	0.905	Rho guanine nucleotide exchange factor 7
12	9606.ENSP00000315477	0.902	CD209 antigen
13	9606.ENSP00000341198	0.895	Neogenin
14	9606.ENSP00000246792	0.874	Ras-related protein R-Ras
15	9606.ENSP00000250617	0.874	Rho guanine nucleotide exchange factor 6
16	9606.ENSP00000369960	0.872	Alpha-1A adrenergic receptor
17	9606.ENSP00000380638	0.871	Protein-tyrosine kinase 2-beta
18	9606.ENSP00000341189	0.864	Focal adhesion kinase 1
19	9606.ENSP00000442736	0.862	Plexin-B3
20	9606.ENSP00000289104	0.860	Ras-related protein M-Ras

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.994	guanyl-nucleotide exchange factor activity
GO:0005102	0.962	signaling receptor binding
GO:0001664	0.779	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.975	response to stimulus
GO:0051716	0.927	cellular response to stimulus
GO:0007165	0.899	signal transduction
GO:0023051	0.882	regulation of signaling
GO:0010646	0.881	regulation of cell communication
GO:0009966	0.755	regulation of signal transduction
GO:1902531	0.750	regulation of intracellular signal transduction
GO:0032502	0.548	developmental process
GO:0051056	0.507	regulation of small GTPase mediated signal transduction
GO:0032501	0.443	multicellular organismal process
GO:0048856	0.385	anatomical structure development
GO:0048518	0.332	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0005576	0.994	extracellular region
GO:0031982	0.987	vesicle
GO:0070062	0.978	extracellular exosome
GO:0016020	0.967	membrane
GO:0071944	0.961	cell periphery
GO:0005886	0.948	plasma membrane
GO:0043229	0.879	intracellular organelle
GO:0043231	0.805	intracellular membrane-bounded organelle
GO:0005634	0.320	nucleus
GO:0070013	0.308	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]