StarFunc result for job id Q9NZN8

User Input

>input (540 residues)
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLA
SPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMS
LHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQ
PSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRRE
GSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGL
LTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSE
YLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWIT
RAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4by6E	0.188	0.550	2.198E-9	168	0.096	0.310	4by6E.pdb.gz	Structure and RNA-Binding Properties of the not1-not2-not5 Module of the Yeast Ccr4-not Complex
2	PDB:7p2pC	0.063	0.141	1.649E-1	174	0.024	0.075	7p2pC.pdb.gz
3	PDB:7pubCj	0.072	0.147	2.342E-1	227	0.043	0.101	7pubCj.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
4	PDB:4adnA	0.067	0.131	3.326E-1	213	0.033	0.085	4adnA.pdb.gz	Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
5	PDB:3jb9G	0.068	0.238	4.725E-1	95	0.019	0.105	3jb9G.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	AFDB:Q59PA6	0.054	0.041	6.097E-1	779	0.169	0.117	Q59PA6.pdb.gz	Q59PA6_CANAL Vac7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAC7 PE=4 SV=1
7	PDB:1c8uA	0.055	0.081	8.991E-1	285	0.017	0.032	1c8uA.pdb.gz
8	PDB:7pnt0	0.074	0.153	9.533E-1	216	0.033	0.083	7pnt0.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
9	PDB:6y0fC	0.064	0.050	1.011	722	0.013	0.010	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
10	PDB:7z4yB	0.093	0.067	1.011	930	0.044	0.026	7z4yB.pdb.gz
11	PDB:7kycA	0.059	0.030	1.136	1178	0.009	0.004	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
12	AFDB:Q1RKN3	0.057	0.027	1.853	1919	0.080	0.022	Q1RKN3.pdb.gz	TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tlh2 PE=2 SV=1
13	AFDB:Q494P4	0.070	0.064	2.083	607	0.131	0.117	Q494P4.pdb.gz	Q494P4_ARATH At2g40070 OS=Arabidopsis thaliana OX=3702 GN=BPP1 PE=1 SV=1
14	AFDB:E7EY47	0.049	0.043	2.341	958	0.137	0.077	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
15	AFDB:P0C7T5	0.078	0.067	2.958	689	0.124	0.097	P0C7T5.pdb.gz	ATX1L_HUMAN Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE=1 SV=1
16	AFDB:Q96QP1	0.071	0.039	3.526	1244	0.157	0.068	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
17	AFDB:D3DMN9	0.067	0.052	4.202	807	0.113	0.076	D3DMN9.pdb.gz	D3DMN9_DROME LD10418p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG11486-RC PE=1 SV=1
18	AFDB:Q9Y149	0.085	0.065	4.202	749	0.152	0.109	Q9Y149.pdb.gz	MED15_DROME Mediator of RNA polymerase II transcription subunit 15 OS=Drosophila melanogaster OX=7227 GN=MED15 PE=2 SV=1
19	AFDB:O45797	0.065	0.045	4.723	908	0.111	0.066	O45797.pdb.gz	WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans OX=6239 GN=wts-1 PE=1 SV=1
20	AFDB:Q9NHC2	0.053	0.035	5.008	916	0.104	0.061	Q9NHC2.pdb.gz	Q9NHC2_DROME Tara 1A isoform OS=Drosophila melanogaster OX=7227 GN=tara PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VUB4	0.0	1077	520	0.963	1.000	F8VUB4_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=2
2	F8VV52	0.0	1087	531	0.974	0.991	F8VV52_HUMAN CCR4-NOT transcription complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
3	F8W145	0.0	548	309	0.537	0.939	F8W145_HUMAN CCR4-NOT transcription complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
4	Q8C5L3	0.0	1118	540	0.998	0.998	CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus OX=10090 GN=Cnot2 PE=1 SV=2
5	Q9NZN8	0.0	1120	540	1.000	1.000	CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
6	F8VRS8	4.53e-139	405	276	0.365	0.714	F8VRS8_HUMAN CCR4-NOT transcription complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
7	Q94547	1.46e-78	259	585	0.211	0.195	RGA_DROME Regulator of gene activity OS=Drosophila melanogaster OX=7227 GN=Rga PE=1 SV=2
8	Q10923	9.16e-62	211	444	0.254	0.309	Q10923_CAEEL NOT2/NOT3/NOT5 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ntl-2 PE=1 SV=1
9	F8VQF4	8.39e-45	156	144	0.137	0.514	F8VQF4_HUMAN CCR4-NOT transcription complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1
10	Q52JK6	6.11e-42	160	603	0.157	0.141	VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana OX=4100 GN=VIP2 PE=1 SV=1
11	A8MR45	4.38e-37	147	614	0.152	0.134	A8MR45_ARATH NOT2 / NOT3 / NOT5 family OS=Arabidopsis thaliana OX=3702 GN=NOT2A PE=1 SV=1
12	Q9FPW4	4.92e-34	138	614	0.143	0.125	VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana OX=3702 GN=VIP2 PE=1 SV=2
13	P87240	7.11e-31	124	306	0.154	0.271	NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not2 PE=1 SV=2
14	Q9V3I9	1.26e-19	93.6	438	0.115	0.142	Q9V3I9_DROME FI22161p1 OS=Drosophila melanogaster OX=7227 GN=BG:DS07851.5 PE=1 SV=1
15	P06100	4.13e-19	87.4	191	0.104	0.293	NOT2_YEAST General negative regulator of transcription subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC36 PE=1 SV=1
16	Q7K126	6.46e-11	67.4	844	0.063	0.040	Q7K126_DROME CCR4-NOT transcription complex subunit 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Not3 PE=1 SV=1
17	Q8K0V4	3.34e-10	65.1	751	0.061	0.044	CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus OX=10090 GN=Cnot3 PE=1 SV=1
18	O75175	3.71e-10	65.1	753	0.061	0.044	CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1
19	E9QGK5	7.09e-10	64.3	901	0.059	0.036	E9QGK5_DANRE CCR4-NOT transcription complex subunit 3 isoform X2 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=1
20	F1Q4L8	7.23e-10	64.3	908	0.059	0.035	F1Q4L8_DANRE CCR4-NOT transcription complex subunit 3 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04153 NOT2_3_5	5.8e-28	109.0	NOT2 / NOT3 / NOT5 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007463605.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007468383.1	0.999	CCR4-NOT transcription complex subunit 1 isoform X1
2	118797.XP_007445918.1	0.997	CCR4-NOT transcription complex subunit 9
3	118797.XP_007463921.1	0.996	CCR4-NOT transcription complex subunit 3
4	118797.XP_007466641.1	0.996	CCR4-NOT transcription complex subunit 4 isoform X1
5	118797.XP_007452906.1	0.992	CCR4-NOT transcription complex subunit 8 isoform X1
6	118797.XP_007465370.1	0.992	CCR4-NOT transcription complex subunit 6
7	118797.XP_007468412.1	0.992	CCR4-NOT transcription complex subunit 11
8	118797.XP_007455472.1	0.991	CCR4-NOT transcription complex subunit 6 like
9	118797.XP_007459971.1	0.990	CCR4-NOT transcription complex subunit 7
10	118797.XP_007464982.1	0.988	CCR4-NOT transcription complex subunit 10
11	118797.XP_007455885.1	0.955	182 kDa tankyrase-1-binding protein
12	118797.XP_007465062.1	0.943	Transducer of ERBB2, 1
13	118797.XP_007451359.1	0.934	Angel homolog 2
14	118797.XP_007451829.1	0.902	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 2 bases in 1 codon
15	118797.XP_007451835.1	0.902	2',5'-phosphodiesterase 12-like
16	118797.XP_007456950.1	0.902	Nocturnin
17	118797.XP_007471617.1	0.892	Cytoplasmic polyadenylation element-binding protein 3 isoform X1
18	118797.XP_007469337.1	0.891	Ski2 like RNA helicase 2
19	118797.XP_007464614.1	0.829	Exosome component 4
20	118797.XP_007463957.1	0.805	Exosome component 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.559	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0009987	0.982	cellular process
GO:0019222	0.981	regulation of metabolic process
GO:0048523	0.961	negative regulation of cellular process
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0051171	0.945	regulation of nitrogen compound metabolic process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0050793	0.926	regulation of developmental process
GO:0010468	0.923	regulation of gene expression
GO:0048522	0.914	positive regulation of cellular process
GO:0009889	0.895	regulation of biosynthetic process
GO:0010556	0.894	regulation of macromolecule biosynthetic process
GO:0031326	0.893	regulation of cellular biosynthetic process
GO:0019219	0.890	regulation of nucleobase-containing compound metabolic process
GO:0051239	0.883	regulation of multicellular organismal process
GO:0010605	0.881	negative regulation of macromolecule metabolic process
GO:0051172	0.863	negative regulation of nitrogen compound metabolic process
GO:0031324	0.862	negative regulation of cellular metabolic process
GO:0032501	0.852	multicellular organismal process
GO:0051252	0.849	regulation of RNA metabolic process
GO:0033143	0.802	regulation of intracellular steroid hormone receptor signaling pathway
GO:0051128	0.799	regulation of cellular component organization
GO:1902115	0.785	regulation of organelle assembly
GO:0032502	0.780	developmental process
GO:0009890	0.767	negative regulation of biosynthetic process
GO:0010558	0.740	negative regulation of macromolecule biosynthetic process
GO:0048856	0.739	anatomical structure development
GO:0031327	0.738	negative regulation of cellular biosynthetic process
GO:0007275	0.720	multicellular organism development
GO:0001824	0.698	blastocyst development
GO:0009653	0.539	anatomical structure morphogenesis
GO:0048646	0.524	anatomical structure formation involved in morphogenesis
GO:0009893	0.521	positive regulation of metabolic process
GO:0001825	0.501	blastocyst formation
GO:0031325	0.479	positive regulation of cellular metabolic process
GO:0051173	0.472	positive regulation of nitrogen compound metabolic process
GO:0008152	0.458	metabolic process
GO:0071704	0.454	organic substance metabolic process
GO:0045935	0.434	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.416	positive regulation of macromolecule metabolic process
GO:0044238	0.415	primary metabolic process
GO:1903506	0.415	regulation of nucleic acid-templated transcription
GO:0006807	0.403	nitrogen compound metabolic process
GO:0044237	0.380	cellular metabolic process
GO:0006355	0.379	regulation of DNA-templated transcription
GO:0051130	0.367	positive regulation of cellular component organization
GO:0043170	0.363	macromolecule metabolic process
GO:0010638	0.353	positive regulation of organelle organization
GO:0034641	0.346	cellular nitrogen compound metabolic process
GO:1902117	0.317	positive regulation of organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005886	0.998	plasma membrane
GO:0032991	0.947	protein-containing complex
GO:0030014	0.371	CCR4-NOT complex
GO:0030015	0.345	CCR4-NOT core complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]